DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3B and SPAC12B10.04

DIOPT Version :9

Sequence 1:NP_609068.2 Gene:TTLL3B / 33946 FlyBaseID:FBgn0031853 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_594636.1 Gene:SPAC12B10.04 / 2542924 PomBaseID:SPAC12B10.04 Length:403 Species:Schizosaccharomyces pombe


Alignment Length:414 Identity:97/414 - (23%)
Similarity:159/414 - (38%) Gaps:137/414 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 RSLLLYVREHQPAELISENGTIFSTTLDFALGKVKKMVRHAEHYSLDDARIKPPTPAEIVENQTF 352
            |:::.|:.:|..:.|.......:|..||:|             ..|||:.::             
pombe    84 RTVITYLAKHPDSILSKSVPEAYSLELDYA-------------EFLDDSLME------------- 122

  Fly   353 MVQSTDVLKSNAKFKVSEKVMAEYARLAGLYLDQIESLRPDYRWDGSRNLWILKPGYQSRGIGIV 417
            ..:....|:.||...:|||                       :|      :||||....|..||.
pombe   123 AYELRQELEENATKNISEK-----------------------QW------YILKPSMCDRAQGIR 158

  Fly   418 IRSSLDDI------------------------LQWTSNN-----QNKKYIVQKYIERPLLIYRTK 453
            :.|:::::                        :....||     |.:.::|||||.:|||:...|
pombe   159 LFSTIEELQAIFDSFDDEESESEEAGLEEKGDITVAFNNKIVISQIRNFLVQKYISKPLLLDHRK 223

  Fly   454 FDIRQYMLLTITDTKVSIWTYRD--CYL-RFSSQEFTMD-DLRESIHLTNNSVQ-KRYKNKTNRD 513
            |.||.|:|.|   ..:|::.:.:  |.| |...::.|.| ||..| ||:|..:| ...:..:.||
pombe   224 FHIRAYVLAT---GALSVYLFNEMLCLLARDKYKKPTPDPDLLFS-HLSNTCLQGDNVEQSSIRD 284

  Fly   514 SRLPKNNMWSL------DQFKNYLRIMGAPDGSWSKTYNGFKQNLVAVVMASLDETELLQNAFEL 572
                   .|:.      |.||:.|.|:|          :.|:    |.........:.|:|.||:
pombe   285 -------FWNTSIENKDDIFKSILNIIG----------DVFE----AAATTQGIHFQPLENCFEI 328

  Fly   573 YGCDFMLDEHYNPILIEINSTPDLSPSTEITARICPMVLKDCIRVVVDLPKNPTAATGLFELAFE 637
            :|.||::|......|:|:||.||...    |.:....::::....||:     ||....||    
pombe   329 FGVDFLVDCESQVYLLEVNSYPDFKQ----TGKNLSNIIENLFSAVVE-----TAIIPFFE---- 380

  Fly   638 VNYSINKGADGKPLELNGKQMTLF 661
              .|..:..|.| |.| .|::.||
pombe   381 --SSTKRNVDSK-LTL-AKKLQLF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL3BNP_609068.2 TTL 325..626 CDD:281171 77/340 (23%)
SPAC12B10.04NP_594636.1 TTL 118..383 CDD:281171 79/346 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1567
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.