DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3B and TTLL5

DIOPT Version :9

Sequence 1:NP_609068.2 Gene:TTLL3B / 33946 FlyBaseID:FBgn0031853 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_055887.3 Gene:TTLL5 / 23093 HGNCID:19963 Length:1281 Species:Homo sapiens


Alignment Length:365 Identity:88/365 - (24%)
Similarity:144/365 - (39%) Gaps:89/365 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 KKMVRHAEHYSLDDARIKPPTPAEIVENQTFMVQSTDVLKSNAKFKVSEKVMAEYARLAGLYLDQ 386
            |.::|....:......|.|         |||::.                  ||||.....|   
Human   136 KNIIRMQHTHGFKAFHILP---------QTFLLP------------------AEYAEFCNSY--- 170

  Fly   387 IESLRPDYRWDGSRNLWILKPGYQSRGIGIVIRSSLDDILQWTSNNQN-----KKYIVQKYIERP 446
                      ...|..||:||...|||.|:           :..||.|     :..:|.:||..|
Human   171 ----------SKDRGPWIVKPVASSRGRGV-----------YLINNPNQISLEENILVSRYINNP 214

  Fly   447 LLIYRTKFDIRQYMLLTITDTKVSIWTYRDCYLRFSSQEFTM--DDLR-ESIHLTNNSVQKRYKN 508
            |||...|||:|.|:|:|..|..| |:.|.:...||::..:..  .::| :.:||||.||.|:..:
Human   215 LLIDDFKFDVRLYVLVTSYDPLV-IYLYEEGLARFATVRYDQGAKNIRNQFMHLTNYSVNKKSGD 278

  Fly   509 KTNRDSRLPK----NNMWSLDQFKNYLRIMGAPDGSWSKTYNGFKQNLVAVVMASLDETELL--- 566
            ..:.|.  |:    .|.||:.....||:..|       :.......::..:::.::...||.   
Human   279 YVSCDD--PEVEDYGNKWSMSAMLRYLKQEG-------RDTTALMAHVEDLIIKTIISAELAIAT 334

  Fly   567 ---------QNAFELYGCDFMLDEHYNPILIEINSTPDLSPSTEITARICPMVLKDCIRVVVDLP 622
                     .:.|||||.|.::|....|.|:|:|.:|.|:....:..:|...::.|...||..:.
Human   335 ACKTFVPHRSSCFELYGFDVLIDSTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVC 399

  Fly   623 KNPT--AATGLFELAFEVN--YSINKGADGKPLELNGKQM 658
            ::|.  |:|......||.:  ....|....:||..:..:|
Human   400 QDPAQRASTRPIYPTFESSRRNPFQKPQRCRPLSASDAEM 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL3BNP_609068.2 TTL 325..626 CDD:281171 78/324 (24%)
TTLL5NP_055887.3 TTL 117..395 CDD:281171 77/319 (24%)
c-MTBD region. /evidence=ECO:0000269|PubMed:25959773 378..488 13/62 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 577..614
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1072..1114
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1199..1281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1567
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.