DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3B and Ttl

DIOPT Version :9

Sequence 1:NP_609068.2 Gene:TTLL3B / 33946 FlyBaseID:FBgn0031853 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_612545.2 Gene:Ttl / 171572 RGDID:621113 Length:377 Species:Rattus norvegicus


Alignment Length:321 Identity:83/321 - (25%)
Similarity:146/321 - (45%) Gaps:65/321 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 TPAEIVENQTFMVQSTDVLKSNAKFKVSEKVMAEYARLAGLYLDQIESLRPDY---RWDGSRNLW 403
            |..|:.|:.::..:|..:..:|.|..|:.........::....|:.|.....|   :.||..|:|
  Rat    83 TSPELSESCSWFPESYVIYPTNLKTPVAPAQNGIQLPVSNSRTDEREFFLASYNRKKEDGEGNVW 147

  Fly   404 ILKPGYQSRGIGIVIRSSLDDILQWTSNNQNKKYIVQKYIERPLLIY--RTKFDIRQYMLLTITD 466
            |.|....::|.||:|.|...::|.:. :||.:.:::|||:|.|||:.  ..|||||.::|:   |
  Rat   148 IAKSSAGAKGEGILISSEASELLDFI-DNQGQVHVIQKYLEHPLLLEPGHRKFDIRSWVLV---D 208

  Fly   467 TKVSIWTYRDCYLRFSSQEFTMDDLRE-SIHLTNNSVQKRYKNKTNRDSRLPKNNMWSLDQFKNY 530
            .:.:|:.||:..||.:|:.:.:|:.:: :.||||:.:||.|.                    |||
  Rat   209 HQYNIYLYREGVLRTASEPYHVDNFQDKTCHLTNHCIQKEYS--------------------KNY 253

  Fly   531 LRIMGAPDGSWSKTYNGFKQNLVAVVMASLDETELLQ-----------------------NAFEL 572
                |..:......:..|.|.|.:.:..:|:.:.|||                       .:|:|
  Rat   254 ----GKYEEGNEMFFEEFNQYLTSALNITLENSILLQIKHIIRSCLMSVEPAISTKHLPYQSFQL 314

  Fly   573 YGCDFMLDEHYNPILIEINSTPDLSPSTEITARICPMVLKDCIRVVV------DLPKNPTA 627
            .|.|||:||.....|||:|..|  :.:.::.|.:|..::...|..|.      .:|:.|.|
  Rat   315 LGFDFMVDEELKVWLIEVNGAP--ACAQKLYAELCQGIVDIAISSVFPPPDTEQVPQQPAA 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL3BNP_609068.2 TTL 325..626 CDD:281171 81/318 (25%)
TtlNP_612545.2 TTL 81..366 CDD:397308 80/312 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.