DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3B and TTLL9

DIOPT Version :9

Sequence 1:NP_609068.2 Gene:TTLL3B / 33946 FlyBaseID:FBgn0031853 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_001008409.1 Gene:TTLL9 / 164395 HGNCID:16118 Length:439 Species:Homo sapiens


Alignment Length:412 Identity:102/412 - (24%)
Similarity:181/412 - (43%) Gaps:94/412 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 QTQARSLLLYVREHQPAEL-ISENGTIFSTTLDFALGKVKKMVRHAEHYSLDD-ARIKPPTPAEI 346
            :|...:.|:.|..|:|..: :.:.|     ..||....|..:..:.:|..:|: .||..      
Human    47 KTTLMNTLMDVLRHRPGWVEVKDEG-----EWDFYWCDVSWLRENFDHTYMDEHVRISH------ 100

  Fly   347 VENQTFMVQSTDVLKSNAKFKVSEKVMAEYARLAGLYLD--------------QIESLRPDYRWD 397
            ..|...:.:...::|:..:|:  :::..|..:|.....|              .:|..|      
Human   101 FRNHYELTRKNYMVKNLKRFR--KQLEREAGKLEAAKCDFFPKTFEMPCEYHLFVEEFR------ 157

  Fly   398 GSRN---LWILKPGYQSRGIGIVIRSSLDDILQW-----TSNNQN-----KKYIVQKYIERPLLI 449
              :|   .||:||..:|:|.||.:...|.||:.|     :|::|.     :.|:.|:|||.|.||
Human   158 --KNPGITWIMKPVARSQGKGIFLFRRLKDIVDWRKDTRSSDDQKDDIPVENYVAQRYIENPYLI 220

  Fly   450 YRTKFDIRQYMLLTITDTKVSIWT-YRDCYLRFSSQEFTMDDLRESIHLTNNSVQKRYKNKTNRD 513
            ...|||:|.|:|:.....:..:|: :|                |:.:||||.:||     ||:.|
Human   221 GGRKFDLRVYVLVMSVFAECLLWSGHR----------------RQDVHLTNVAVQ-----KTSPD 264

  Fly   514 SRLPKNNMWSLDQFKNYLRIMGAPDG---SWSKTYNGFKQNLVAVVMASLDETELLQNAFELYGC 575
            ....|...|:|.:|:.||.....|:.   .:....|.|.::|.:|....:.:    ::.|||||.
Human   265 YHPKKGCKWTLQRFRQYLASKHGPEAVETLFRDIDNIFVKSLQSVQKVIISD----KHCFELYGY 325

  Fly   576 DFMLDEHYNPILIEINSTPDLSPSTEITARICPMVLKDCIRVVVDLPKNPTA---ATGLFELAFE 637
            |.::|:...|.|:|:|::|.|:.|::....:...:|:|.:. |||:....|.   ..|.|:|.: 
Human   326 DILIDQDLKPWLLEVNASPSLTASSQEDYELKTCLLEDTLH-VVDMEARLTGREKRVGGFDLMW- 388

  Fly   638 VNYSINKG----ADGKPLELNG 655
                 |.|    .:|.| :|:|
Human   389 -----NDGPVSREEGAP-DLSG 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL3BNP_609068.2 TTL 325..626 CDD:281171 83/332 (25%)
TTLL9NP_001008409.1 TTL 92..368 CDD:281171 79/317 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148127
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1567
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.