DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3B and TTL

DIOPT Version :9

Sequence 1:NP_609068.2 Gene:TTLL3B / 33946 FlyBaseID:FBgn0031853 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_714923.1 Gene:TTL / 150465 HGNCID:21586 Length:377 Species:Homo sapiens


Alignment Length:340 Identity:91/340 - (26%)
Similarity:155/340 - (45%) Gaps:70/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 KMVRHAEHYSLDDARIKPPTPAEIVENQTFMVQSTDVLKSNAKFKVSEKVMAEYARLAGLYLDQI 387
            |:.|.|....|    ||  |..|:.|:.|:..:|..:..:|.|..|:.........::....|:.
Human    70 KLCRKASLVKL----IK--TSPELAESCTWFPESYVIYPTNLKTPVAPAQNGIQPPISNSRTDER 128

  Fly   388 ESLRPDY---RWDGSRNLWILKPGYQSRGIGIVIRSSLDDILQWTSNNQNKKYIVQKYIERPLLI 449
            |.....|   :.||..|:||.|....::|.||:|.|...::|.:. :||.:.:::|||:|.|||:
Human   129 EFFLASYNRKKEDGEGNVWIAKSSAGAKGEGILISSEASELLDFI-DNQGQVHVIQKYLEHPLLL 192

  Fly   450 Y--RTKFDIRQYMLLTITDTKVSIWTYRDCYLRFSSQEFTMDDLRE-SIHLTNNSVQKRYKNKTN 511
            .  ..|||||.::|:   |.:.:|:.||:..||.:|:.:.:|:.:: :.||||:.:||.|.    
Human   193 EPGHRKFDIRSWVLV---DHQYNIYLYREGVLRTASEPYHVDNFQDKTCHLTNHCIQKEYS---- 250

  Fly   512 RDSRLPKNNMWSLDQFKNYLRIMGAPDGSWSKTYNGFKQNLVAVVMASLDETELLQ--------- 567
                            |||    |..:......:..|.|.|.:.:..:|:.:.|||         
Human   251 ----------------KNY----GKYEEGNEMFFKEFNQYLTSALNITLESSILLQIKHIIRNCL 295

  Fly   568 --------------NAFELYGCDFMLDEHYNPILIEINSTPDLSPSTEITARICPMVLKDCIRVV 618
                          .:|:|:|.|||:||.....|||:|..|  :.:.::.|.:|..::...|..|
Human   296 LSVEPAISTKHLPYQSFQLFGFDFMVDEELKVWLIEVNGAP--ACAQKLYAELCQGIVDIAISSV 358

  Fly   619 -----VDLPKNPTAA 628
                 |:.|:...||
Human   359 FPPPDVEQPQTQPAA 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL3BNP_609068.2 TTL 325..626 CDD:281171 88/334 (26%)
TTLNP_714923.1 TTL 81..367 CDD:397308 84/317 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5560
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1567
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.