DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3B and ttll5

DIOPT Version :9

Sequence 1:NP_609068.2 Gene:TTLL3B / 33946 FlyBaseID:FBgn0031853 Length:756 Species:Drosophila melanogaster
Sequence 2:XP_012823512.2 Gene:ttll5 / 100158545 XenbaseID:XB-GENE-5889203 Length:1128 Species:Xenopus tropicalis


Alignment Length:278 Identity:76/278 - (27%)
Similarity:127/278 - (45%) Gaps:44/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 RNLWILKPGYQSRGIGIVIRSSLDDILQWTSNNQNKKYIVQKYIERPLLIYRTKFDIRQYMLLTI 464
            |..||:||...|||.|:.:.:| ..::....|     .:|.:||..||||...|||:|.|:|:|.
 Frog   172 RGPWIVKPVASSRGRGVYLINS-PSLISMEDN-----ILVSRYIGNPLLIDGFKFDVRLYVLITS 230

  Fly   465 TDTKVSIWTYRDCYLRFSSQEFTMDDLRESI-----HLTNNSVQKRYKNKTNRDSRLPK----NN 520
            .|..| |:.|.:...||::.::  |...::|     ||||.||.|:..:..:.|.  |.    .|
 Frog   231 YDPLV-IYLYEEGLTRFATAKY--DRAAKNIKNQFMHLTNYSVNKKSGDYVSCDD--PDVEDYGN 290

  Fly   521 MWSLDQFKNYLRIMGAPDGSWSKTYNGFKQNLV--AVVMASLDETELLQ-------NAFELYGCD 576
            .||:.....||:    .||..:.......::|:  .:|.|.|......:       |.|||||.|
 Frog   291 KWSMSAMLRYLK----QDGKDTAALMSQVEDLIIKTIVSAELPIASACKSLITHRGNCFELYGFD 351

  Fly   577 FMLDEHYNPILIEINSTPDLSPSTEITARICPMVLKDCIRVVVDLPKNP-----TAATGLFELAF 636
            .::|.:..|.|:|:|.:|.|:....:..::...::.|...:|....::|     .|::.|::...
 Frog   352 VLIDGNLKPWLLEVNLSPSLACDAPLDLKVKASMISDMFTLVGVECQDPQQRFGRASSSLYDKRT 416

  Fly   637 EVNYSINKGADGKPLELN 654
            :      |....:||..|
 Frog   417 Q------KSTHQRPLSAN 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL3BNP_609068.2 TTL 325..626 CDD:281171 70/248 (28%)
ttll5XP_012823512.2 TTL 113..390 CDD:397308 68/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.