DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment homer and Homer3

DIOPT Version :9

Sequence 1:NP_001036341.2 Gene:homer / 33944 FlyBaseID:FBgn0025777 Length:531 Species:Drosophila melanogaster
Sequence 2:XP_036009953.1 Gene:Homer3 / 26558 MGIID:1347359 Length:368 Species:Mus musculus


Alignment Length:334 Identity:105/334 - (31%)
Similarity:153/334 - (45%) Gaps:93/334 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TKAVINSTITPNMTFTQTSQKFGQWSDVRANTVYGLGFASEAELTKFVEKFQEVKEATKNAM-KS 116
            ::|:||||:|||||||:||||||||:|.|||||||||||||.:||:|.|||||||||.:.|. ||
Mouse    58 SQAIINSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQQLTQFAEKFQEVKEAARLAREKS 122

  Fly   117 ANGSNAVTPTTSANTSPISGRAVGSMQNDNTAIDPHTVEPPNMSNTNTQNANPDSPSHKLLNTSD 181
            .:|                    |...:...|:..|.|.|..:.:||       .|..:.|..|.
Mouse   123 QDG--------------------GEFTSTGLALASHQVPPSPLVSTN-------GPGEEKLFRSQ 160

  Fly   182 VKADIGSATPSPQPTSGVTGGGGVTISSGGSIVGMHTGPGAGATAEQQLKYENERLKMALAQSCA 246
             .||      :|.||                                    |.||||..|::...
Mouse   161 -SAD------TPGPT------------------------------------ERERLKKMLSEGSV 182

  Fly   247 NAKKWEIELATLKNNNIRLTSALQESTANVDEWKRQLHTYKEENIRLKRDMEQL-------CVGG 304
            ...:||.|...|:::|.||..||:|:.|...:|::||...:.|...|::.:.:|       .|..
Mouse   183 GEVQWEAEFFALQDSNQRLAGALREANAAATQWRQQLEVQRAEAELLRQRVAELEAQVAVEPVRA 247

  Fly   305 GVVAAAGGGATEDELR-----REVATLKART-------EQLQKELMQQELEL---KSANISLREK 354
            |...|......:.|.|     :|:.|||.::       :..::|..||::::   .||::..|..
Mouse   248 GEKEATSQSVEQLEARVQTKDQEIQTLKNQSTGTREAPDTAEREETQQQVQVGCRTSADLETRNA 312

  Fly   355 SNDQTLAKL 363
            ..:|.|..:
Mouse   313 ELEQQLRSM 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
homerNP_001036341.2 EVH1_Homer_Vesl 3..111 CDD:269917 46/57 (81%)
Homer3XP_036009953.1 PH-like <58..116 CDD:418428 46/57 (81%)
Smc <153..>349 CDD:224117 47/212 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 164 1.000 Domainoid score I3921
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 242 1.000 Inparanoid score I3302
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1251658at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44098
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10918
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1808
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
99.030

Return to query results.
Submit another query.