DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AkhR and SIFaR

DIOPT Version :9

Sequence 1:NP_995639.1 Gene:AkhR / 33942 FlyBaseID:FBgn0025595 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001163674.1 Gene:SIFaR / 42530 FlyBaseID:FBgn0038880 Length:758 Species:Drosophila melanogaster


Alignment Length:361 Identity:88/361 - (24%)
Similarity:173/361 - (47%) Gaps:54/361 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKVAEENDHRDLSNWSNVNDTNGTIHLTKDMVFNDGHRLSITV-----YSILFVISTIGNSTVLY 61
            |..|.::.:.....|..:   :|::....|.::.  |.|::::     |.::|::..||||.|:.
  Fly   172 AAAATKSYNDSALRWEQL---DGSVDFGFDPLYR--HSLAMSMVYCVAYIVVFLVGLIGNSFVIA 231

  Fly    62 LLTKRRLRGP-LR--IDIMLMHLAIADLMVTLLLMPMEIVWAWTVQWLSTDLMCRLMSFFRVFGL 123
            ::    ||.| :|  .:..:::|||||::|.:..:|..::....|.|:...|||:.:.:.:...:
  Fly   232 VV----LRAPRMRTVTNYFIVNLAIADILVIVFCLPATLIGNIFVPWMLGWLMCKFVPYIQGVSV 292

  Fly   124 YLSSYVMVCISLDRYFAILKPLKR-SYNRGRIMLACAWLGSVVCSIPQAFLFHLEEHPAVTGYFQ 187
            ..|.|.::.:||||:.||..|||: :..|.|||:...|:.::|.:||....|.|.  ||...:..
  Fly   293 AASVYSLIAVSLDRFIAIWWPLKQMTKRRARIMIIGIWVIALVTTIPWLLFFDLV--PAEEVFSD 355

  Fly   188 CVIFNSFRSDF----------DEKLY-QAASMCSMYAFPLIMFIYCYGAIYLEIYRKSQRVLKDV 241
            .::....:..|          |..|| ..|::.:.|..|:.:...||..|::::..:|      :
  Fly   356 ALVSAYSQPQFLCQEVWPPGTDGNLYFLLANLVACYLLPMSLITLCYVLIWIKVSTRS------I 414

  Fly   242 IAERFRRSNDDVLSRAKKRTLKMTITIVIVFIICWTPYYTISMWYWLDKHSAGKINPLLRKALFI 306
            ..|......|.:..::|.:.:||.:.:||:|::.|.|.|.|..........:.:...:|:|.:.:
  Fly   415 PGESKDAQMDRMQQKSKVKVIKMLVAVVILFVLSWLPLYVIFARIKFGSDISQEEFEILKKVMPV 479

  Fly   307 ---FASTNSCMNPLVYGLYNIRGRMNNNNPSVNNRH 339
               ..|:|||:||::|              |||.::
  Fly   480 AQWLGSSNSCINPILY--------------SVNKKY 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AkhRNP_995639.1 7tm_1 55..319 CDD:278431 74/281 (26%)
SIFaRNP_001163674.1 7tm_4 216..>443 CDD:304433 61/238 (26%)
7tm_1 225..495 CDD:278431 74/281 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472989
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24241
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.