DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AkhR and CCKLR-17D3

DIOPT Version :9

Sequence 1:NP_995639.1 Gene:AkhR / 33942 FlyBaseID:FBgn0025595 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001097023.1 Gene:CCKLR-17D3 / 32864 FlyBaseID:FBgn0030954 Length:584 Species:Drosophila melanogaster


Alignment Length:392 Identity:87/392 - (22%)
Similarity:148/392 - (37%) Gaps:125/392 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ITVYSILFVISTIGNSTVL-YLLTKRRLRGPLRIDIMLMHLAIADLMVTLLLMPMEIVWAWTVQW 105
            |..||::.:.:.:||..|: .|:..||:|  ...::.|::|||:|:::.:|.||:.:|......:
  Fly   115 IPSYSMILLFAVLGNLLVISTLVQNRRMR--TITNVFLLNLAISDMLLGVLCMPVTLVGTLLRNF 177

  Fly   106 LSTDLMCRLMSFFRVFGLYLSSYVMVCISLDRYFAILKPLK-RSY---NRGRIMLACAWLGSVVC 166
            :..:.:|:|..|.:...:.:||:.:|.||.:||:||..||: ||:   :....::...|||.::|
  Fly   178 IFGEFLCKLFQFSQAASVAVSSWTLVAISCERYYAICHPLRSRSWQTISHAYKIIGFIWLGGILC 242

  Fly   167 SIPQAFLFHL--EEHPAVTGYFQCVIFNSFRSDFD-EKLYQAASMCSMYAFPLIMFIYCY----G 224
            ..|.|....|  ...|   ||.:|   ..|..|.. |..|.......:...||::....|    .
  Fly   243 MTPIAVFSQLIPTSRP---GYCKC---REFWPDQGYELFYNILLDFLLLVLPLLVLCVAYILITR 301

  Fly   225 AIYLEIYRKSQRVLKD------------------------------------------------- 240
            .:|:.:.:.|.|:|:.                                                 
  Fly   302 TLYVGMAKDSGRILQQSLPVSATTAGGSAPNPGTSSSSNCILVLTATAVYNENSNNNNGNSEGSA 366

  Fly   241 -----------------------------------------VIAERFRRSNDDVLSRAKKRTLKM 264
                                                     |.....||||:.....:|||.:||
  Fly   367 GGGSTNMATTTLTTRPTAPTVITTTTTTTVTLAKTSSPSIRVHDAALRRSNEAKTLESKKRVVKM 431

  Fly   265 TITIVIVFIICWTPYYTISMWYWLDKHSAGKINPLLRK--------ALFIFASTNSCMNPLVYGL 321
            ...:|:.|.|||||.|.|:....|       |.|::.:        .|.:.|.::||.||:.|..
  Fly   432 LFVLVLEFFICWTPLYVINTMVML-------IGPVVYEYVDYTAISFLQLLAYSSSCCNPITYCF 489

  Fly   322 YN 323
            .|
  Fly   490 MN 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AkhRNP_995639.1 7tm_1 55..319 CDD:278431 82/373 (22%)
CCKLR-17D3NP_001097023.1 7tm_4 120..>244 CDD:304433 36/125 (29%)
7tm_1 128..487 CDD:278431 82/373 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.