DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AkhR and gnrr-3

DIOPT Version :9

Sequence 1:NP_995639.1 Gene:AkhR / 33942 FlyBaseID:FBgn0025595 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_509685.2 Gene:gnrr-3 / 191147 WormBaseID:WBGene00013871 Length:395 Species:Caenorhabditis elegans


Alignment Length:322 Identity:79/322 - (24%)
Similarity:145/322 - (45%) Gaps:45/322 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SNVNDTNGTIHLTKDMVFNDGHRLSITVYSILFVISTIGNSTVLYLLTKRRLR-GPL--RIDIML 78
            ::.:||...:|.|.:::        ...|.:.|.|.....:...::.|.|.:| |.:  |:..:.
 Worm     3 NSTSDTFVMMHSTSEVI--------EMFYQLAFFIIGTPINIFAFVKTSRNVREGGVESRLVKLS 59

  Fly    79 MHLAIADLMVTLLLMPMEIVWAWTVQWLSTDLMCRLMSFFRVFGLYLSSYVMVCISLDRYFAILK 143
            ..|.||.:||..:.......|.:.:.|...|:|||:.||......:|.|.::..|::|....|..
 Worm    60 RQLLIAHIMVLFMYGIWRSYWIYNIVWTQGDIMCRVFSFLCALPFHLWSNMVAAIAIDMLCCITS 124

  Fly   144 PLKRSY----NRGRIMLACAWLGSVVCSIPQAFL---FHLEEHPAVTGYFQCVIFNSFRSDFDEK 201
            ||. ||    ||...::..||..:|||:.|.:.|   ..:.:......|.:..:||      |:.
 Worm   125 PLS-SYRTGANRVNWLITLAWGFAVVCASPMSILRGTIQINDEDMYQCYPRTDVFN------DDV 182

  Fly   202 L--YQAASMCSMYAFPLIMFIYCYGAIYLEIYRK--SQRVLKDVIAERFRRSNDDVLSRAKKRTL 262
            |  :....:.:.:..||::.|.||.||.:.|.::  .:|:|:|. .:..:::|:     .|.|.|
 Worm   183 LIAFNLFHVITSFYIPLLIVIICYLAIGVSIRKQMAERRLLQDG-GQSGQKTNN-----TKARFL 241

  Fly   263 KMTITIVIVFIICWTPYYTISMWYWL-----DKHSAGKINPLLRKALFIFASTNSCMNPLVY 319
            :.::.|:..|:..|.||..:::...:     .:....|:|.|   ...|.|||  |:||.:|
 Worm   242 RASVAIICTFLFTWLPYQVLALLRIVCVSENCQEIVSKLNWL---QAIIIAST--CINPFLY 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AkhRNP_995639.1 7tm_1 55..319 CDD:278431 71/282 (25%)
gnrr-3NP_509685.2 7tm_classA_rhodopsin-like 62..298 CDD:381740 66/253 (26%)
TM helix 3 94..116 CDD:381740 6/21 (29%)
TM helix 4 138..154 CDD:381740 5/15 (33%)
TM helix 5 184..207 CDD:381740 4/22 (18%)
TM helix 6 238..263 CDD:381740 7/24 (29%)
TM helix 7 276..298 CDD:381740 10/26 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.