DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AkhR and gnrr-5

DIOPT Version :9

Sequence 1:NP_995639.1 Gene:AkhR / 33942 FlyBaseID:FBgn0025595 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_504228.2 Gene:gnrr-5 / 186759 WormBaseID:WBGene00019224 Length:423 Species:Caenorhabditis elegans


Alignment Length:403 Identity:87/403 - (21%)
Similarity:154/403 - (38%) Gaps:131/403 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RLSITVYSILFVISTIGNSTVLYLLTK------RRLRGPLRIDIMLMHLAIADLMVTLLLMPMEI 97
            ::.:.:|.|:|.   ||....|..|::      |..:...:|.::.:.|.:||||...|.:|.:|
 Worm    32 KIEVCIYVIVFF---IGGPLNLMALSRSLRAFSRTHKAKSQILLLRITLNLADLMTLFLYVPKQI 93

  Fly    98 VWAWTVQWLSTDLMCRLMSFFRVFGLYLSSYVMVCISLDRYF-----AILKPLKRSYNRGRIMLA 157
            :|..|.||...:.:||..:||..|..||:|:|:.||::||.|     :.|...:::|.|.|.:|.
 Worm    94 IWLITYQWYGGEFLCRACAFFSTFSFYLNSFVIACIAIDRVFGAYNISSLNAHRKAYIRCRNLLG 158

  Fly   158 CAWLGSVVCSIPQAFLFHLEEHPAVTGYFQC-VIFNSF-----------------RSDFDEKLYQ 204
            |.|:.:.:.|:|||.:|..........:.|| .||..|                 |...||   :
 Worm   159 CGWVLAFLLSLPQAVVFTTTSPYENIDFKQCATIFMIFLHEKRIEYHDPATTDIRREQIDE---E 220

  Fly   205 AASM---CSMYAFPLIMFIYCYGAI-----YLEIYRKSQRVLKDVIAE----RFRRSNDDVLS-- 255
            ||||   ..|||....:|::....|     |:.:....|..||...|.    .||..:.|:::  
 Worm   221 AASMERWEKMYAINHFLFVFWIPCIVIIGSYIVVLLILQGHLKQDKASTSCFNFRVKSSDIMTID 285

  Fly   256 ----------------------------------------------------------------- 255
                                                                             
 Worm   286 ETQSTTTRSPTRSTYLLQQEESFALRSSSSYDFESHNSHPTRQGSIRSRASTGGGSKFGAMAVST 350

  Fly   256 --RAKKRTLKMTITIVIVFIICWTPY--YTISMWYWLD-----KHSAGKINPLLRKALFIFASTN 311
              |||:...:....|::.::..|:||  :|:...:.:.     :|....:|..:        ..|
 Worm   351 IHRAKQHAKRQAALIIVAYLCIWSPYNLFTVLNLFGMPIMEELRHFLSFLNAAI--------CVN 407

  Fly   312 SCMNPLVYGLYNI 324
            :.:||::||::::
 Worm   408 TVVNPIIYGVFSM 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AkhRNP_995639.1 7tm_1 55..319 CDD:278431 81/380 (21%)
gnrr-5NP_504228.2 7tm_GPCRs 35..420 CDD:391938 87/398 (22%)
TM helix 1 35..62 CDD:341315 7/29 (24%)
TM helix 2 70..97 CDD:341315 10/26 (38%)
TM helix 3 108..138 CDD:341315 14/29 (48%)
TM helix 4 152..173 CDD:341315 8/20 (40%)
TM helix 5 228..257 CDD:341315 6/28 (21%)
TM helix 6 353..383 CDD:341315 8/29 (28%)
TM helix 7 391..419 CDD:341315 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D368588at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X690
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.