DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp and LOC100535166

DIOPT Version :9

Sequence 1:NP_001137802.1 Gene:Tsp / 33941 FlyBaseID:FBgn0031850 Length:1060 Species:Drosophila melanogaster
Sequence 2:XP_003200334.3 Gene:LOC100535166 / 100535166 -ID:- Length:387 Species:Danio rerio


Alignment Length:335 Identity:59/335 - (17%)
Similarity:111/335 - (33%) Gaps:125/335 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 TLDI---SANGATESRNFEIPNINETSTI----RSLALQFSKNRITLHVDCKASTHHDIDMNLAK 144
            |||:   ||.|.      ::.::.:....    |::.|...::|..::|.|:.....::|:.:.:
Zfish   126 TLDLVFWSAGGQ------QVVSVEDVELADGHWRNITLFVQEDRAQVYVGCEEINTQELDLPIQQ 184

  Fly   145 LYTQMDDPV--IKLFRERKYPLHFDGDMEH-----------SLQRANCQKGN----------HRR 186
            :..|.:..:  :::.:.......|.|.:::           .|:...||..:          |..
Zfish   185 ILDQQNAEISGLRIAKGAAKSDRFMGVLQNVRFVFGTTVDAILRNKGCQSSSFIPDVLTLEKHVN 249

  Fly   187 GNRRMLRNKITEREKNKKRDVRGWYEPTIAREGVVDHRHQEVPTDVERGDIPVLNGDCED--ALA 249
            |:...:|...|..:....:||.|:                                .|:|  ::.
Zfish   250 GSSPAIRTHYTGHKTKDLQDVCGF--------------------------------SCDDLTSMF 282

  Fly   250 RSLSDLLALVKLLREDVAHQRQEIAYLRMLLENCAGCKNPLTTDNQLRIEPDCRSANPCYPGVEC 314
            :.|..|..:||.|..|:   ||                  :|.||.|     .::....:.|| |
Zfish   283 KELKGLGVVVKQLSNDL---RQ------------------VTADNNL-----IKTQIKVHEGV-C 320

  Fly   315 L---------DSAAGPRCGHCPLGFIGDGKSCKPGVTCAHHMCYPGVQC-HDTVNGAQCDSCP-- 367
            |         |......|.||         :|:...|....:..|.:.| :.||...:|  ||  
Zfish   321 LHNRIVYQDRDEWTVDSCTHC---------TCQNSATVCREISCPLMPCANATVPEGEC--CPRC 374

  Fly   368 -----AGYEG 372
                 ||.:|
Zfish   375 GTPSDAGIDG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TspNP_001137802.1 EGF_CA 477..513 CDD:284955
TSP3 repeat_1C 563..595 CDD:275367
TSP3 repeat_short 632..654 CDD:275365
TSP_3 656..690 CDD:280556
TSP3 repeat_long 656..690 CDD:275366
TSP3 repeat_short 691..713 CDD:275366
TSP3 repeat_long 714..751 CDD:275365
TSP_3 715..751 CDD:280556
TSP3 repeat_short 752..787 CDD:275366
TSP_3 789..822 CDD:280556
TSP_C 841..1038 CDD:283408
coiled coil 245..286 CDD:293927 9/42 (21%)
TSPcc_insect 245..286 CDD:293927 9/42 (21%)
EGF_CA 343..377 CDD:214542 10/38 (26%)
EGF_CA 421..457 CDD:238011
LOC100535166XP_003200334.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D120983at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.