DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nhe3 and Nha2

DIOPT Version :10

Sequence 1:NP_723202.2 Gene:Nhe3 / 33939 FlyBaseID:FBgn0028703 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001247251.1 Gene:Nha2 / 42710 FlyBaseID:FBgn0263390 Length:714 Species:Drosophila melanogaster


Alignment Length:41 Identity:14/41 - (34%)
Similarity:17/41 - (41%) Gaps:15/41 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SPLKMLLSSAPRQAGTSIGQTVKQPPQAGIQMQIPVPTGPQ 48
            |.||....|.|::|.|          |||     |.|.||:
  Fly    90 STLKRAARSEPQRART----------QAG-----PRPEGPK 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nhe3NP_723202.2 Na_H_Exchanger 155..>531 CDD:470090
Nha2NP_001247251.1 NhaP 279..>686 CDD:439796
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.