DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cort and CDC20

DIOPT Version :9

Sequence 1:NP_001260144.1 Gene:cort / 33937 FlyBaseID:FBgn0000351 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001246.2 Gene:CDC20 / 991 HGNCID:1723 Length:499 Species:Homo sapiens


Alignment Length:555 Identity:114/555 - (20%)
Similarity:204/555 - (36%) Gaps:152/555 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DSPNKNS------KLDKKSLTPF-KKVRRKNWKQEAAYKSDTSKGQEVSYV--------GERFIP 58
            |:|..|:      :..|::..|. ..:|..|....|......:.|:..|.|        |:|:||
Human    17 DAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIP 81

  Fly    59 NR-----------FERENIEFNLKYIGKRKERDILETGVTLTASYWRQSGFISNINRTFGIGERR 112
            :|           ..:||...|.:...|::                .|..:..|:| .|.:.|.:
Human    82 HRSAAQMEVASFLLSKENQPENSQTPTKKE----------------HQKAWALNLN-GFDVEEAK 129

  Fly   113 LFQFSSQ-----QGTRSRVVDNDSADSDWPCNPRARPYAIQNATHEMPGICSPV--------DY- 163
            :.:.|.:     :|.::|:....|        .:|.|.:.:.....:|.:...:        || 
Human   130 ILRLSGKPQNAPEGYQNRLKVLYS--------QKATPGSSRKTCRYIPSLPDRILDAPEIRNDYY 186

  Fly   164 -NMMDWSSGGMVAMSSGQDVMLW-RNLDESTMVFSVESP----TSLKYSPDGKHLAIGCMDRNYP 222
             |::|||||.::|::....|.|| .:..:...:..:|.|    :|:.:..:|.:||:|.....  
Human   187 LNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAE-- 249

  Fly   223 VLDLWEVRSPTEFLVSYRKLFFKSMGYISCIEWSHDGKEVICGTQCGVI----IVLAMPTLNTLM 283
             :.||:|:.....    |.:...| ..:..:.|  :...:..|::.|.|    :.:|...:.|  
Human   250 -VQLWDVQQQKRL----RNMTSHS-ARVGSLSW--NSYILSSGSRSGHIHHHDVRVAEHHVAT-- 304

  Fly   284 QLREHRHTVKKMKFAPTHKYFASSDTDGKIFIFDA-------VLKVRLLKLDGRSIVFDWHPWTG 341
             |..|...|..:::||..::.||...|..:.::.:       |......:..|......|.||..
Human   305 -LSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQS 368

  Fly   342 EDLAV-AERSPASIFIFNIPRRQFVASYRRRDDRIVIKTLTYSKITGELLVNVIRRDDADLAVCE 405
            ..||. ...|...|.|:|:                         .:|..|..|    ||...||.
Human   369 NVLATGGGTSDRHIRIWNV-------------------------CSGACLSAV----DAHSQVCS 404

  Fly   406 IL----------------------VLASLNRVVDLMSHQDRGTLFLMWNPDGTKIATGGLDDTFS 448
            ||                      ...::.:|.:|..|..| .|.|..:|||..:|:...|:|..
Human   405 ILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSR-VLSLTMSPDGATVASAAADETLR 468

  Fly   449 LWNFFPTYKREAILRKQEQKAKDKCSSLSLYKGIR 483
            ||..|   :.:...|::.:||....||| :::|||
Human   469 LWRCF---ELDPARRREREKASAAKSSL-IHQGIR 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cortNP_001260144.1 WD40 <166..453 CDD:225201 69/325 (21%)
WD40 166..451 CDD:295369 68/323 (21%)
WD40 repeat 201..244 CDD:293791 9/42 (21%)
WD40 repeat 251..287 CDD:293791 7/39 (18%)
WD40 repeat 292..326 CDD:293791 7/40 (18%)
WD40 repeat 334..369 CDD:293791 9/35 (26%)
WD40 repeat 377..419 CDD:293791 10/63 (16%)
WD40 repeat 427..466 CDD:293791 12/38 (32%)
CDC20NP_001246.2 WD 3 266..303 6/39 (15%)
WD40 repeat 272..307 CDD:293791 7/39 (18%)
WD 4 307..346 7/38 (18%)
WD40 repeat 312..352 CDD:293791 7/39 (18%)
WD 5 353..395 12/66 (18%)
WD40 repeat 359..397 CDD:293791 12/66 (18%)
WD 6 397..438 7/40 (18%)
WD40 repeat 402..440 CDD:293791 5/37 (14%)
WD 7 441..480 13/42 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..80 13/62 (21%)
WD 1 182..221 12/38 (32%)
WD40 repeat 188..224 CDD:293791 10/35 (29%)
WD40 190..471 CDD:238121 68/323 (21%)
WD 2 224..263 9/45 (20%)
WD40 repeat 229..266 CDD:293791 9/43 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19918
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.