DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cort and AT5G27945

DIOPT Version :9

Sequence 1:NP_001260144.1 Gene:cort / 33937 FlyBaseID:FBgn0000351 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_568505.1 Gene:AT5G27945 / 832862 AraportID:AT5G27945 Length:428 Species:Arabidopsis thaliana


Alignment Length:348 Identity:67/348 - (19%)
Similarity:119/348 - (34%) Gaps:122/348 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 GQDVMLWRNLDESTMVFS-------VESP-TSLKYSPDGKHLAIGCMDRNYPVLD---------- 225
            |..|.||   |.|:...|       ...| ||:.::.||..||:|..:....|.|          
plant   129 GDTVYLW---DASSCYTSKLVTIDDENGPVTSINWTQDGLDLAVGLDNSEVQVWDCVSNRHVRTL 190

  Fly   226 -----------LW-----------------EVRSPTEFLVSYRKLFFKSMGY---ISCIEWSHDG 259
                       .|                 :||..:..:.:|       :|:   :..::||..|
plant   191 RGGHESRVGSLAWNNHILTTGGMDGKIVNNDVRIRSSIIGTY-------VGHTEEVCGLKWSESG 248

  Fly   260 KEVICGTQCGVI------IVLAMPTLNTLMQLREHRHTVKKMKFAPTHKYFASSD---TDGKIFI 315
            |::..|....|:      :..:.||...|.:..||...|:.:.:.|......::.   .||||..
plant   249 KKLASGGNDNVVHIWDRSLASSNPTRQWLHRFEEHTAAVRALAWCPFQASLLATGGGVGDGKINF 313

  Fly   316 FDAVLKVRLLKLDGRSIVFDWHPWTGEDL-AVAERSPASIFIFNIPRRQFVASYRRRDDRIVIKT 379
                                |:..||..| :|...|.....:::...|:.::::          .
plant   314 --------------------WNTHTGACLNSVETGSQVCSLLWSKSERELLSAH----------G 348

  Fly   380 LTYSKITGELLVNVIRRDDADLAVCEILVLASLNRVVDLMSHQDRGTLFLMWNPDGTKIATGGLD 444
            .|.:::|                   :....|:.::.:|..|..| .||:..:|||..:|:...|
plant   349 FTQNQLT-------------------LWKYPSMVKMAELNGHTSR-VLFMAQSPDGCTVASAAGD 393

  Fly   445 DTFSLWNFF---PTYKREAILRK 464
            :|..|||.|   |...::|..:|
plant   394 ETLRLWNVFGEPPKTTKKAASKK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cortNP_001260144.1 WD40 <166..453 CDD:225201 63/332 (19%)
WD40 166..451 CDD:295369 61/330 (18%)
WD40 repeat 201..244 CDD:293791 13/80 (16%)
WD40 repeat 251..287 CDD:293791 9/41 (22%)
WD40 repeat 292..326 CDD:293791 6/36 (17%)
WD40 repeat 334..369 CDD:293791 7/35 (20%)
WD40 repeat 377..419 CDD:293791 3/41 (7%)
WD40 repeat 427..466 CDD:293791 15/41 (37%)
AT5G27945NP_568505.1 WD40 <111..406 CDD:225201 64/336 (19%)
WD40 131..400 CDD:295369 60/328 (18%)
WD40 repeat 156..193 CDD:293791 9/36 (25%)
WD40 repeat 198..233 CDD:293791 4/41 (10%)
WD40 repeat 240..280 CDD:293791 9/39 (23%)
WD40 repeat 287..323 CDD:293791 9/55 (16%)
WD40 repeat 331..369 CDD:293791 4/66 (6%)
WD40 repeat 375..399 CDD:293791 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0305
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19918
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.