DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cort and CDC20.3

DIOPT Version :9

Sequence 1:NP_001260144.1 Gene:cort / 33937 FlyBaseID:FBgn0000351 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_198060.2 Gene:CDC20.3 / 832766 AraportID:AT5G27080 Length:442 Species:Arabidopsis thaliana


Alignment Length:476 Identity:96/476 - (20%)
Similarity:181/476 - (38%) Gaps:140/476 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ERFIPNRFERENIEFNLKYIGKRKERDILETGVTLTASYWRQSGFISNINRTFGIGERRLFQFSS 118
            :|||||| ...:.:|....:.:.::|::.|.......:|..|...:.|.|||      |:..|.:
plant    23 DRFIPNR-SAMDFDFANYALTQGRKRNVDEITSASRKAYMTQLAVVMNQNRT------RILAFRN 80

  Fly   119 QQGTRSRVVDNDSADSDWPCNPRA---RPYAIQNATH--EMPGICSPVDYNMMDWSSGGMVAMSS 178
            :.   ..::.::.:||... ||::   |.|..||:..  :.||:......|::||.|..::|::.
plant    81 KP---KALLSSNHSDSPHQ-NPKSVKPRRYIPQNSERVLDAPGLMDDFYLNLLDWGSANVLAIAL 141

  Fly   179 GQDVMLW----RNLDESTMVFSVESP-TSLKYSPDGKHLAIGCMDRNYPVLDLW----------- 227
            |..|.||    .:..|...:...:.| ||:.::.||..||:| :|.:  .:.||           
plant   142 GDTVYLWDASSGSTSELVTIDEDKGPVTSINWTQDGLDLAVG-LDNS--EVQLWDFVSNRQVRTL 203

  Fly   228 ------------------------------EVRSPTEFLVSYRKLFFKSMGY---ISCIEWSHDG 259
                                          :||..:..:.:|       :|:   :..::||..|
plant   204 IGGHESRVGSLAWNNHILTTGGMDGKIVNNDVRIRSSIVGTY-------LGHTEEVCGLKWSESG 261

  Fly   260 KEVICGTQCGVI-------IVLAMPTLNTLMQLREHRHTVKKMKFAPTHKYFASSD---TDGKIF 314
            |::..|....|:       :..:.||...|.:..||...|:.:.:.|......::.   .||||.
plant   262 KKLASGGNYNVVHIWDHRSVASSKPTRQWLHRFEEHTAAVRALAWCPFQATLLATGGGVGDGKIK 326

  Fly   315 IFDAVLKVRLLKLDGRSIVFDWHPWTGEDL-AVAERSPASIFIFNIPRRQFVASYRRRDDRIVIK 378
            .                    |:..||..| :|...|.....:::...|:.::|:          
plant   327 F--------------------WNTHTGACLNSVETGSQVCSLLWSQRERELLSSH---------- 361

  Fly   379 TLTYSKITGELLVNVIRRDDADLAVCEILVLASLNRVVDLMSHQDRGTLFLMWNPDGTKIATGGL 443
            ..|.:::|                   :....|::::.:|..|..| .||:..:|:|..:|:...
plant   362 GFTQNQLT-------------------LWKYPSMSKMAELNGHTSR-VLFMAQSPNGCTVASAAG 406

  Fly   444 DDTFSLWNFF----PTYKREA 460
            |:...|||.|    .|.|:.|
plant   407 DENLRLWNVFGEPPKTTKKAA 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cortNP_001260144.1 WD40 <166..453 CDD:225201 64/346 (18%)
WD40 166..451 CDD:295369 62/344 (18%)
WD40 repeat 201..244 CDD:293791 13/83 (16%)
WD40 repeat 251..287 CDD:293791 9/42 (21%)
WD40 repeat 292..326 CDD:293791 6/36 (17%)
WD40 repeat 334..369 CDD:293791 8/35 (23%)
WD40 repeat 377..419 CDD:293791 3/41 (7%)
WD40 repeat 427..466 CDD:293791 13/38 (34%)
CDC20.3NP_198060.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0305
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19918
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.