DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cort and fzy

DIOPT Version :9

Sequence 1:NP_001260144.1 Gene:cort / 33937 FlyBaseID:FBgn0000351 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_477501.1 Gene:fzy / 34968 FlyBaseID:FBgn0001086 Length:526 Species:Drosophila melanogaster


Alignment Length:537 Identity:120/537 - (22%)
Similarity:192/537 - (35%) Gaps:173/537 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SPNKNS--KLDKKSLTPFKKVRRKNWKQEAAYKSDTSKGQEVSYVGERFIPNR----FERENIEF 68
            :|.|:|  |..|.:.||                |.|..|      |:||||||    ||..:...
  Fly    63 TPGKSSEGKTKKSNTTP----------------SKTPGG------GDRFIPNRAATNFELAHFLV 105

  Fly    69 NLKYIGKRKERDILETGVTLTASYWRQSGFISNINRTFGIGERRLFQFSSQQGTRSRVVD----- 128
            |.....|..|.:...|.              ||.|.:       ..|.|:.:|.|.:::.     
  Fly   106 NKDSGDKSDEENDKATS--------------SNSNES-------NVQASAHKGDRQKLISEVAQV 149

  Fly   129 NDSADSDWPCNPRARPYAIQNATHEMP-----GICSPV------------------------DY- 163
            .||......|.....|.|.:  ||..|     .|.:|:                        || 
  Fly   150 GDSKGGRILCYQNKAPAAPE--THNNPLKVVYSIKTPISTKSGSRYIPTTSERILDAPDFINDYY 212

  Fly   164 -NMMDWSSGGMVAMSSGQDVMLWR----NLDESTMVFSVESPTSLKYSPDGKHLAIGCMDRNYPV 223
             |:||||:..:||::.|..|.||.    |:::.|.....:...||.:..:|:.||||   .:...
  Fly   213 LNLMDWSADNIVAVALGSCVYLWNAQTGNIEQLTEFEEGDYAGSLSWIQEGQILAIG---NSTGA 274

  Fly   224 LDLWEVRSPTEFLVSYRKLFFKSMGYISCIEWSHDGKEVICGTQCGVIIVLAMPTLNTLMQLREH 288
            ::||:...     |...::.......:..:.|  :...|..|::.|.|:       :..::.|||
  Fly   275 VELWDCSK-----VKRLRVMDGHSARVGSLAW--NSFLVSSGSRDGTIV-------HHDVRAREH 325

  Fly   289 R------HT--VKKMKFAPTHKYFASSDTDGKIFIFDAV------------------LKVRLLKL 327
            :      ||  |..:|::...||.||...|..:.::.|.                  ..||.|. 
  Fly   326 KLSTLSGHTQEVCGLKWSTDFKYLASGGNDNLVNVWSAASGGVGTATDPLHKFNDHQAAVRALA- 389

  Fly   328 DGRSIVFDWHPWTGEDLA----VAERSPASIFIFNIPRRQFVASYRRRDDRIVIKTLTYSKITGE 388
                    |.||....||    .|:|   .|..:|:.....:.|.   |.:..:.:|.:|:...|
  Fly   390 --------WCPWQPSTLASGGGTADR---CIKFWNVNNGTLMKSV---DSKSQVCSLLFSRHYKE 440

  Fly   389 LLV------NVIRRDDADLAVCEILVLASLNRVVDLMSHQDRGTLFLMWNPDGTKIATGGLDDTF 447
            |:.      |.:          .|....::.:..||..|..| .|.:..:|||:.:.:.|.|:|.
  Fly   441 LISAHGFANNQL----------TIWKYPTMVKQADLTGHTSR-VLQMAMSPDGSTVISAGADETL 494

  Fly   448 SLWNFF---PTYKREAI 461
            .|||.|   |...::|:
  Fly   495 RLWNCFAPDPLASKKAV 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cortNP_001260144.1 WD40 <166..453 CDD:225201 74/326 (23%)
WD40 166..451 CDD:295369 72/324 (22%)
WD40 repeat 201..244 CDD:293791 10/42 (24%)
WD40 repeat 251..287 CDD:293791 5/35 (14%)
WD40 repeat 292..326 CDD:293791 10/51 (20%)
WD40 repeat 334..369 CDD:293791 10/38 (26%)
WD40 repeat 377..419 CDD:293791 7/47 (15%)
WD40 repeat 427..466 CDD:293791 13/38 (34%)
fzyNP_477501.1 WD40 <208..500 CDD:225201 77/334 (23%)
WD40 216..498 CDD:238121 72/324 (22%)
WD40 repeat 256..291 CDD:293791 10/42 (24%)
WD40 repeat 297..332 CDD:293791 8/43 (19%)
WD40 repeat 337..373 CDD:293791 8/35 (23%)
WD40 repeat 386..424 CDD:293791 12/52 (23%)
WD40 repeat 429..467 CDD:293791 7/47 (15%)
WD40 repeat 473..513 CDD:293791 13/39 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0305
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19918
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.