DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cort and fzr1b

DIOPT Version :9

Sequence 1:NP_001260144.1 Gene:cort / 33937 FlyBaseID:FBgn0000351 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_003197866.1 Gene:fzr1b / 100148604 ZFINID:ZDB-GENE-131120-69 Length:485 Species:Danio rerio


Alignment Length:529 Identity:116/529 - (21%)
Similarity:197/529 - (37%) Gaps:181/529 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GERFIPNRFERENIEFNLKYIGK--------RKERDI-LETG--VTLTASYWRQSGFISNINRTF 106
            |:||||.| ...|...|..|..:        ::.:|. .:||  ....|:..|        |...
Zfish    40 GDRFIPTR-AGSNWSINFHYANENCWSPNQNQRAKDASTDTGKDAVAYAALLR--------NELL 95

  Fly   107 GIG----------ERR----------LFQFSSQQGTRSRVVDNDSADSDWPCNPRARPYA---IQ 148
            |.|          :||          ||:::..  |:....||:.:           ||:   :.
Zfish    96 GAGIETVPDPHTDDRRHTILTQDTHSLFRYTIH--TKRVPFDNEIS-----------PYSLSPLS 147

  Fly   149 NATHEM---------------------PGICSPVDYNMMDWSSGGMVAMSSGQDVMLW------- 185
            |.:|::                     |.:......|::|||:|.::::..|..|.||       
Zfish   148 NKSHKLLRSPRKPARKISKIPFKVLDAPELQDDFYLNLVDWSAGNLLSVGLGACVYLWSACTSQV 212

  Fly   186 -RNLDESTMVFSVESPTSLKYSPDGKHLAIGCMDRNYPVLDLWEVRSPTEFLVSYRKLFFKSM-G 248
             |..|.|.   ..:|.||:.::..|..:|:|   .:...:.:|:.       ...|||  .|: |
Zfish   213 TRLCDLSV---DGDSVTSVCWNERGSLVAVG---THKGFVQIWDA-------AGGRKL--TSLEG 262

  Fly   249 Y---ISCIEWSHDGKEVICGTQCGVII---VLAMPTLNTLMQLREHRHTVKKMKFAPTHKYFASS 307
            :   :..:.|  :|:::..|::..||:   |...|.:.  .:|:.||..|..:|::|.|::.||.
Zfish   263 HSARVGALAW--NGEQLSSGSRDRVILQRDVRTPPPVE--RRLQGHRQEVCGLKWSPDHQHLASG 323

  Fly   308 DTDGKIFIFD--AVLKVR--------------------LLKLDG----RSIVFDWHPWTGEDLAV 346
            ..|.|:.:::  ::|.|:                    ||...|    |.:.| |:..||:.|  
Zfish   324 GNDNKLLVWNSSSLLPVQQYSDHLAAVKAIAWSPHQHGLLASGGGTADRCLRF-WNTLTGQAL-- 385

  Fly   347 AERSPASIFIFNIPRRQFVASYRRRDDRIVIKTLTYSKITGELLVNVIRRDDADLAVCEILV--L 409
                                  :..|....:..|.:||...||:      .....:..:|||  .
Zfish   386 ----------------------QSTDTGSQVCNLAWSKHANELV------STHGYSQNQILVWKY 422

  Fly   410 ASLNRVVDLMSHQDRGTLFLMWNPDGTKIATGGLDDTFSLWNFFPTYKREAILRKQEQKAKDKCS 474
            .||.:|..|..|..| .|:|..:|||..|.||..|:|...||.|          .:.:..|:..|
Zfish   423 PSLTQVAKLTGHSYR-VLYLAVSPDGEAIVTGAGDETLRFWNVF----------SKTRCTKESKS 476

  Fly   475 SLSLYKGIR 483
            .|:|:..||
Zfish   477 VLNLFTRIR 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cortNP_001260144.1 WD40 <166..453 CDD:225201 79/329 (24%)
WD40 166..451 CDD:295369 77/327 (24%)
WD40 repeat 201..244 CDD:293791 9/42 (21%)
WD40 repeat 251..287 CDD:293791 8/38 (21%)
WD40 repeat 292..326 CDD:293791 11/55 (20%)
WD40 repeat 334..369 CDD:293791 5/34 (15%)
WD40 repeat 377..419 CDD:293791 11/43 (26%)
WD40 repeat 427..466 CDD:293791 13/38 (34%)
fzr1bXP_003197866.1 WD40 91..482 CDD:225201 101/472 (21%)
WD40 186..463 CDD:238121 77/327 (24%)
WD40 repeat 225..262 CDD:293791 10/48 (21%)
WD40 repeat 268..303 CDD:293791 8/38 (21%)
WD40 repeat 308..343 CDD:293791 10/34 (29%)
WD40 repeat 351..389 CDD:293791 9/62 (15%)
WD40 repeat 394..432 CDD:293791 11/43 (26%)
WD40 repeat 438..479 CDD:293791 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0305
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.