DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galt and galt

DIOPT Version :9

Sequence 1:NP_001260142.1 Gene:Galt / 33935 FlyBaseID:FBgn0263200 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001025703.1 Gene:galt / 595095 XenbaseID:XB-GENE-6453444 Length:247 Species:Xenopus tropicalis


Alignment Length:240 Identity:141/240 - (58%)
Similarity:176/240 - (73%) Gaps:2/240 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 MCFHPKSNLTLPTMSAAEIVVVIDEWISQFNELSAKYAWVQIFENKGAAMGCSNPHPHCQIWSCS 172
            |||||.|::|||.||..|:..|||.|.....:|.|.|.||||||||||.|||||||||||||:.:
 Frog     1 MCFHPWSDITLPLMSVPELRGVIDRWAEILCDLGATYPWVQIFENKGAMMGCSNPHPHCQIWASN 65

  Fly   173 FLPTEPQLKQERLRAYYATNERPMLADYVERELQRQERIVIENRDWLVVVPFWATWPFETMLISR 237
            |||.|.|.::...|.|...:..|||.||...|..|:||:|:.|..||||||:||.|||:|:|:.|
 Frog    66 FLPNEAQTEERTQRQYLREHGEPMLLDYCRLEETRKERVVVANEHWLVVVPYWAVWPFQTLLLPR 130

  Fly   238 NNNKRINDLTAEQRYNLALTIKELTTKYDNLFQCSFPYSMGWHGAPTGPEHAHASSAHWTLHAIY 302
            .:..|:.||::|:|.:||..:|.|.:||||||:.|||||||||||||| ::.....:||.|||.:
 Frog   131 RHVLRLQDLSSEERDSLASIMKRLLSKYDNLFEISFPYSMGWHGAPTG-QYLGEDCSHWQLHAHF 194

  Fly   303 YPPLLRSASVRKFMVGFELLAMAQRDLTPEQAAQRLREVDGKCHY 347
            ||||||||:|||||||:|:||.||||||.||||:|||.:..: ||
 Frog   195 YPPLLRSATVRKFMVGYEMLAQAQRDLTAEQAAERLRNLPEE-HY 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaltNP_001260142.1 PRK11720 1..350 CDD:236963 141/240 (59%)
GalT 10..341 CDD:238341 139/232 (60%)
galtNP_001025703.1 GalT <2..241 CDD:330499 140/239 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 158 1.000 Domainoid score I4091
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H126
Inparanoid 1 1.050 263 1.000 Inparanoid score I3005
OMA 1 1.010 - - QHG51955
OrthoDB 1 1.010 - - D1135699at2759
OrthoFinder 1 1.000 - - FOG0004454
OrthoInspector 1 1.000 - - oto102946
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R471
SonicParanoid 1 1.000 - - X3738
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.