DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galt and IL11RA

DIOPT Version :10

Sequence 1:NP_609062.2 Gene:Galt / 33935 FlyBaseID:FBgn0263200 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001136256.1 Gene:IL11RA / 3590 HGNCID:5967 Length:422 Species:Homo sapiens


Alignment Length:284 Identity:56/284 - (19%)
Similarity:78/284 - (27%) Gaps:121/284 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 CPGVT-----------RPNGIQTPEY---------------ESTYVFENDFPALVEVVPVPPNND 92
            |||||           .|..:|.|:.               |.||:.:....||...|.:     
Human    48 CPGVTAGDPVSWFRDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTL----- 107

  Fly    93 DPLFQIA--PARGNCRVMCFHPKSNLTLPTMS--AAEIVVVIDEWI-SQFNELSAKYAWVQIFEN 152
                |:.  |||                |.:|  ||:.......|. ||.:.|..:|.   ....
Human   108 ----QLGYPPAR----------------PVVSCQAADYENFSCTWSPSQISGLPTRYL---TSYR 149

  Fly   153 KGAAMGCSNPH--PHCQIWSCSFLPTEPQLKQERLRAYYATNERPMLADYVERELQRQERIVIEN 215
            |...:|..:..  |....|.|   |.:|      |.|                     .|.|:..
Human   150 KKTVLGADSQRRSPSTGPWPC---PQDP------LGA---------------------ARCVVHG 184

  Fly   216 RDWLVVVPFWATWPFETMLISRNNNKRINDLTAEQRYNLALTIKELTTKYDNLFQCSFPYSMGWH 280
            .:      ||:.:        |.|...:|.|.|..|.        |.....::.:...|..:...
Human   185 AE------FWSQY--------RINVTEVNPLGASTRL--------LDVSLQSILRPDPPQGLRVE 227

  Fly   281 GAPTGPEHAHASSAHWTLHAIYYP 304
            ..|..|....||   ||     ||
Human   228 SVPGYPRRLRAS---WT-----YP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaltNP_609062.2 PRK11720 1..350 CDD:236963 56/284 (20%)
IL11RANP_001136256.1 IG_like 33..109 CDD:214653 14/69 (20%)
Ig strand B 44..48 CDD:409533 56/284 (20%)
Ig strand E 77..81 CDD:409533 0/3 (0%)
Ig strand F 91..97 CDD:409533 2/5 (40%)
Ig strand G 102..105 CDD:409533 0/2 (0%)
FN3 218..310 CDD:238020 9/34 (26%)
WSXWS motif 304..308
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..355
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..422
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.