DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galt and Il11ra2

DIOPT Version :10

Sequence 1:NP_609062.2 Gene:Galt / 33935 FlyBaseID:FBgn0263200 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_036019628.1 Gene:Il11ra2 / 16158 MGIID:109123 Length:436 Species:Mus musculus


Alignment Length:180 Identity:37/180 - (20%)
Similarity:61/180 - (33%) Gaps:53/180 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 SNPHPHCQI-----WSCSF-------LPTE--PQLKQERLRAYYATNERPMLADY-VERELQRQE 209
            :.|...||.     :||::       |||.  ...:::.|....:..|.|....: ..::.....
Mouse   118 ARPEVSCQAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEAS 182

  Fly   210 RIVIENRDWLVVVPFWATWPFETMLISRNNNKRINDLTAEQRYNLALTIKELTTKYDNLFQCSFP 274
            |.|:...:      ||:.:        |.|...:|.|.|....        |..:..::.:...|
Mouse   183 RCVVHGAE------FWSEY--------RINVTEVNPLGASTCL--------LDVRLQSILRPDPP 225

  Fly   275 YSMGWHGAPTGPEHAHASSAHWTLHAIYYPPLLRSASVRK---FMVGFEL 321
            ..:.....|..|...|||   ||     ||     ||.|:   |::.|.|
Mouse   226 QGLRVESVPGYPRRLHAS---WT-----YP-----ASWRRQPHFLLKFRL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaltNP_609062.2 PRK11720 1..350 CDD:236963 37/180 (21%)
Il11ra2XP_036019628.1 IG_like 37..99 CDD:214653
Ig strand B 48..52 CDD:409533
Ig strand C 60..63 CDD:409533
Ig strand E 81..85 CDD:409533
Ig strand F 95..101 CDD:409533
Ig strand G 106..109 CDD:409533
FN3 222..314 CDD:238020 16/54 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.