DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galt and Il11ra1

DIOPT Version :10

Sequence 1:NP_609062.2 Gene:Galt / 33935 FlyBaseID:FBgn0263200 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_034679.1 Gene:Il11ra1 / 16157 MGIID:107426 Length:432 Species:Mus musculus


Alignment Length:180 Identity:37/180 - (20%)
Similarity:61/180 - (33%) Gaps:53/180 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 SNPHPHCQI-----WSCSF-------LPTE--PQLKQERLRAYYATNERPMLADY-VERELQRQE 209
            :.|...||.     :||::       |||.  ...:::.|....:..|.|....: ..::.....
Mouse   114 ARPEVSCQAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEAS 178

  Fly   210 RIVIENRDWLVVVPFWATWPFETMLISRNNNKRINDLTAEQRYNLALTIKELTTKYDNLFQCSFP 274
            |.|:...:      ||:.:        |.|...:|.|.|....        |..:..::.:...|
Mouse   179 RCVVHGAE------FWSEY--------RINVTEVNPLGASTCL--------LDVRLQSILRPDPP 221

  Fly   275 YSMGWHGAPTGPEHAHASSAHWTLHAIYYPPLLRSASVRK---FMVGFEL 321
            ..:.....|..|...|||   ||     ||     ||.|:   |::.|.|
Mouse   222 QGLRVESVPGYPRRLHAS---WT-----YP-----ASWRRQPHFLLKFRL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaltNP_609062.2 PRK11720 1..350 CDD:236963 37/180 (21%)
Il11ra1NP_034679.1 IG_like 33..95 CDD:214653
Ig strand B 44..48 CDD:409353
Ig strand C 56..59 CDD:409353
Ig strand E 77..81 CDD:409353
Ig strand F 91..97 CDD:409353
Ig strand G 102..105 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..170 3/18 (17%)
FN3 218..310 CDD:238020 16/54 (30%)
WSXWS motif 304..308
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..332
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..361
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.