DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13771 and AT5G48370

DIOPT Version :9

Sequence 1:NP_609061.2 Gene:CG13771 / 33933 FlyBaseID:FBgn0031844 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_199648.1 Gene:AT5G48370 / 834890 AraportID:AT5G48370 Length:438 Species:Arabidopsis thaliana


Alignment Length:310 Identity:83/310 - (26%)
Similarity:135/310 - (43%) Gaps:32/310 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KFQPKQDELPNRSMLDSQTTAQVLLETDALLRQRFVYGRGLLRMGRIIEELDLLAVWICHLHIHL 138
            |..|.|.:|..|:...|:||......||.:||:::......:|:|.::|:||.||..|...|.  
plant    58 KDAPPQSQLLTRTPSHSRTTIFYPFSTDFILREQYRDPWNEVRIGILLEDLDALAGTISVKHC-- 120

  Fly   139 PNLPEGVPLPYTFITMLVDHAHFLQDKFIADADVSLSGHVSYTDNNFMEVTAYVRQSGM------ 197
             :..:....|...:|..| |...|:.....|.|:.:...|.:...:.:|:...|.||.:      
plant   121 -SDDDSTTRPLLLVTASV-HKIVLKKPICVDIDLKIVASVIWVGRSSIEIQLEVMQSELKDVKAS 183

  Fly   198 -----LLAKGIFVVEARDAINNGPAPVNPLVPANELEESLHQEAQKRHQERAKA----LYRLESQ 253
                 |.|..|||  |||:.....||:|.|.|..|:|:.|.:||:.|:..|.|.    ....:..
plant   184 SDSVALTANFIFV--ARDSKTGKAAPINRLSPETEVEKLLFEEAEARNNLRKKKRGGDRREFDHG 246

  Fly   254 QPTKEEQQLMYELFTRTKGDDGPSPSDMTTLPP-NSRWMSTWRRRTLMHPFPENRNESNTIFGGF 317
            :..|.|..|.          :|...|||..|.. ||..:...|....:...|:.||....|||||
plant   247 ECKKLEAWLA----------EGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGF 301

  Fly   318 IIRKAIEISYMTASLYSNQRCMIRFIADVTFAHSIPVHSYIKLKAYVVFT 367
            ::.:|.|:::.||..::........:..|.|...:.|..:::.|:.|::|
plant   302 LMHRAFELAFSTAYTFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYT 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13771NP_609061.2 BFIT_BACH 91..220 CDD:239526 37/139 (27%)
BFIT_BACH 289..400 CDD:239526 19/79 (24%)
AT5G48370NP_199648.1 PLN02647 1..427 CDD:215349 83/310 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 116 1.000 Domainoid score I1965
eggNOG 1 0.900 - - E1_COG1607
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I1842
OMA 1 1.010 - - QHG55517
OrthoDB 1 1.010 - - D786592at2759
OrthoFinder 1 1.000 - - FOG0002448
OrthoInspector 1 1.000 - - mtm1130
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12655
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1631
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.