DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13771 and Acot12

DIOPT Version :9

Sequence 1:NP_609061.2 Gene:CG13771 / 33933 FlyBaseID:FBgn0031844 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_083066.1 Gene:Acot12 / 74156 MGIID:1921406 Length:556 Species:Mus musculus


Alignment Length:373 Identity:70/373 - (18%)
Similarity:128/373 - (34%) Gaps:79/373 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RGLLRMGRIIEELDLLAVWICHLHIHLPNLPEGVPLPYTFITMLVDHAHFLQDKFIADADVSLSG 176
            ||.|..|::::.:|..|......|..:           :.:|..:|...| :|.......:::..
Mouse    24 RGELSAGQLLKWMDTTACLAAEKHAGI-----------SCVTASMDDILF-EDTARIGQIITIRA 76

  Fly   177 HVSYTDNNFMEVTAYV--------RQSGMLLAKGIFVVEARDAINNGPAPVNPLVPANELEESLH 233
            .|:...:..||::..|        .|..:.:|...||.:   .:......:.|::...|.|:..|
Mouse    77 KVTRAFSTSMEISIKVIVQDKFTGIQKLLCVAFSTFVAK---PVGKEKVHLKPVLLQTEQEQVEH 138

  Fly   234 QEAQKRHQERAKALYRLESQQP----TKEEQQLMYELFTRTKGDD---GPSPSDM-TTLPPNSRW 290
            ..|.:|.:      .||:.:..    .||..:....:....:|..   |.|...: ..|||::  
Mouse   139 NLASERRK------VRLQHENTFNNIMKESSRFSDSICNEEEGTATTMGTSVQSIELVLPPHA-- 195

  Fly   291 MSTWRRRTLMHPFPENRNESNTIFGGFIIRKAIEISYMTASLYSNQRCMIRFIADVTFAHSIPVH 355
                             |.....|||.|:.....::.::||...:....::.:....|.....|.
Mouse   196 -----------------NHHGNTFGGQIMAWMETVATISASRLCHGHPFLKSVDMFKFRGPSTVG 243

  Fly   356 SYIKLKAYVVFTHENYIQLLTVVNAIDGNSFTELKCNVLHLTYSCSKAV---------PEILP-- 409
            ..:...|.|..|.:|.:::...|.|.|...:.|.:...::..:....||         |.|.|  
Mouse   244 DRLVFSAIVNNTFQNSVEVGVRVEAFDCQEWAEGQGRHINSAFLIYNAVDDQEKLITFPRIQPIS 308

  Fly   410 ----RSYHEAL---WYLTGRRYFNRFRESV--SHDMD---NGSAVETN 445
                |.|..|:   ....||:|....::.|  |...|   .||...||
Mouse   309 KDDFRRYQGAIARRRIRLGRKYVISHKKEVPLSAQWDISKKGSLSNTN 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13771NP_609061.2 BFIT_BACH 91..220 CDD:239526 19/115 (17%)
BFIT_BACH 289..400 CDD:239526 17/110 (15%)
Acot12NP_083066.1 BFIT_BACH 4..116 CDD:239526 19/106 (18%)
Coenzyme A binding. /evidence=ECO:0000250 54..56 1/1 (100%)
Coenzyme A binding. /evidence=ECO:0000250 83..85 0/1 (0%)
BFIT_BACH 182..306 CDD:239526 25/142 (18%)
Coenzyme A binding. /evidence=ECO:0000250 235..237 0/1 (0%)
SRPBCC 312..547 CDD:387369 13/45 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.