DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13771 and Acot10

DIOPT Version :9

Sequence 1:NP_609061.2 Gene:CG13771 / 33933 FlyBaseID:FBgn0031844 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_073727.2 Gene:Acot10 / 64833 MGIID:1928940 Length:439 Species:Mus musculus


Alignment Length:400 Identity:132/400 - (33%)
Similarity:201/400 - (50%) Gaps:14/400 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VAKKIREHVGVEGGY--HI-IPKSRDGLLKFQPK-QDELPNRSMLDSQTTAQVLLETDALLRQRF 108
            |..|:||.||:...:  |: ..:.|..|..|.|| |..||.|.:.||.....:.|.||..||.::
Mouse    39 VQVKLREIVGISTVWRDHVQAMEERKLLHSFLPKSQKVLPPRKIRDSYIEVLLPLGTDPELRDKY 103

  Fly   109 VYGRGLLRMGRIIEELDLLAVWICHLHIHLPNLPEGVPLPYTFITMLVDHAHFLQDKFIADADVS 173
            |..:..:|.|||:|:||.|.|.:|::|.|  |....:.| .:.:|:|||.....:.....:.|:.
Mouse   104 VTVQNTVRFGRILEDLDSLGVLVCYMHNH--NHSTNMSL-LSIVTVLVDKIDMCKHSLSPEQDIK 165

  Fly   174 LSGHVSYTDNNFMEVTAYVRQ-----SGMLLAKGIFVVEARDAINNGPAPVNPLVPANELEESLH 233
            .:||||:..|..|||...:.|     :...:....||:.|:|:.|..||.||||:|.|:.||.|.
Mouse   166 FTGHVSWVGNTTMEVKMKMFQLHDDETYWPVLDATFVMVAQDSENKRPAFVNPLIPENKEEEELF 230

  Fly   234 QEAQKRHQER-AKALYRLESQQPTKEEQQLMYELFTRTKGDDGPSPSDMTTLPPNSRWMSTWRRR 297
            .:.:.....| |.:...|....|:.||:.:::|||..|. |..........|||.:.||...:.:
Mouse   231 TQGELNKSRRIAFSTSSLLKVAPSSEERNIIHELFLSTL-DPKTISFQSRILPPKAVWMEDTKLK 294

  Fly   298 TLMHPFPENRNESNTIFGGFIIRKAIEISYMTASLYSNQRCMIRFIADVTFAHSIPVHSYIKLKA 362
            :|....|:.||..|.|||||::|||.|:::.||..:...|..:..:.|:.|...:.|.|.:.|.:
Mouse   295 SLDICHPQERNVFNRIFGGFLMRKAYELAWATACSFGGSRPYVVTVDDIMFQKPVEVGSLLFLSS 359

  Fly   363 YVVFTHENYIQLLTVVNAIDGNSFTELKCNVLHLTYSCSKAVPEILPRSYHEALWYLTGRRYFNR 427
            .|.||..||||:.........:|...:..||.|.|:...|.||.|.|::|.|::.||.|:|:|..
Mouse   360 QVCFTQGNYIQVRVHSEVFSLDSREHMTTNVFHFTFMSEKEVPLIFPKTYGESMLYLDGQRHFKS 424

  Fly   428 FRESVSHDMD 437
            ....|:...|
Mouse   425 MSTPVTLKKD 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13771NP_609061.2 BFIT_BACH 91..220 CDD:239526 41/133 (31%)
BFIT_BACH 289..400 CDD:239526 36/110 (33%)
Acot10NP_073727.2 BFIT_BACH 91..217 CDD:239526 41/128 (32%)
BFIT_BACH 286..406 CDD:239526 40/119 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842011
Domainoid 1 1.000 275 1.000 Domainoid score I1737
eggNOG 1 0.900 - - E1_COG1607
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8206
Inparanoid 1 1.050 275 1.000 Inparanoid score I2935
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55517
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002448
OrthoInspector 1 1.000 - - mtm8823
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12655
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1631
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.