DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13771 and Acot9

DIOPT Version :9

Sequence 1:NP_609061.2 Gene:CG13771 / 33933 FlyBaseID:FBgn0031844 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_062710.2 Gene:Acot9 / 56360 MGIID:1928939 Length:439 Species:Mus musculus


Alignment Length:402 Identity:137/402 - (34%)
Similarity:207/402 - (51%) Gaps:18/402 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VAKKIREHVGVEGGY--HI-IPKSRDGLLKFQPK-QDELPNRSMLDSQTTAQVLLETDALLRQRF 108
            |..|:||.|||...:  |: ..:.|..|..|.|| |..||.|.|.||.....:.|.||..||.::
Mouse    39 VRDKLREIVGVSTVWRDHVKAMEERKLLHSFLPKSQKVLPPRKMRDSYIEVLLPLGTDPELRDKY 103

  Fly   109 VYGRGLLRMGRIIEELDLLAVWICHLHIHLPNLPEGVPLPYTFITMLVDHAHFLQDKFIADADVS 173
            |..:..:|.|||:|:||.|.|.:|::|.|..:....   |.:.:|:|||.....:.....:.|:.
Mouse   104 VTVQNTVRFGRILEDLDSLGVLVCYMHNHNHSTKMS---PLSIVTVLVDKIDMCKHSLSPEQDIK 165

  Fly   174 LSGHVSYTDNNFMEVTAYVRQ-----SGMLLAKGIFVVEARDAINNGPAPVNPLVPANELEESLH 233
            .:||||:..|..|||...:.|     ....:....||:.|||:.|.|||.||||:|.|:.||.|.
Mouse   166 FTGHVSWVGNTSMEVKMKMFQLHNDEKYWPVLDATFVMVARDSENKGPAFVNPLIPENKEEEELF 230

  Fly   234 QEAQKRHQER-AKALYRLESQQPTKEEQQLMYELFTRTKGDDGPSPSDMTTLPPNSRWMSTWRRR 297
            ::.:.....| |.:...|....|:.||:.:::|||..|. |..........|||.:.||...:.:
Mouse   231 KQGELNKSRRIAFSTSSLLKVAPSSEERNIIHELFLTTL-DPKTISFQSRILPPKAVWMEDTKLK 294

  Fly   298 TLMHPFPENRNESNTIFGGFIIRKAIEISYMTASLYSNQRCMIRFIADVTFAHSIPVHSYIKLKA 362
            :|....|:.||..|.|||||::|||.|:::.||..:...|..:..:.|:.|...:.|.|.:.|.:
Mouse   295 SLDICHPQERNVFNRIFGGFLMRKAYELAWATACSFGGSRPYVVTVDDIMFQKPVEVGSLLFLSS 359

  Fly   363 YVVFTHENYIQLL--TVVNAIDGNSFTELKCNVLHLTYSCSKAVPEILPRSYHEALWYLTGRRYF 425
            .|.||.:||||:.  :.|:::|  |...:..||.|.|:...|.||.|.|::|.|::.||.|:|:|
Mouse   360 QVCFTQDNYIQVRVHSEVSSLD--SREHMTTNVFHFTFMSEKEVPLIFPKTYGESMLYLDGQRHF 422

  Fly   426 NRFRESVSHDMD 437
            ......|:...|
Mouse   423 KSMSTPVTLKKD 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13771NP_609061.2 BFIT_BACH 91..220 CDD:239526 42/133 (32%)
BFIT_BACH 289..400 CDD:239526 38/112 (34%)
Acot9NP_062710.2 BFIT_BACH 91..217 CDD:239526 42/128 (33%)
BFIT_BACH 286..406 CDD:239526 42/121 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842015
Domainoid 1 1.000 275 1.000 Domainoid score I1737
eggNOG 1 0.900 - - E1_COG1607
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8206
Inparanoid 1 1.050 275 1.000 Inparanoid score I2935
Isobase 1 0.950 - 0 Normalized mean entropy S5060
OMA 1 1.010 - - QHG55517
OrthoDB 1 1.010 - - D786592at2759
OrthoFinder 1 1.000 - - FOG0002448
OrthoInspector 1 1.000 - - mtm8823
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12655
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1631
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.820

Return to query results.
Submit another query.