DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13771 and acot11a

DIOPT Version :9

Sequence 1:NP_609061.2 Gene:CG13771 / 33933 FlyBaseID:FBgn0031844 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_005171231.1 Gene:acot11a / 554842 ZFINID:ZDB-GENE-050522-538 Length:579 Species:Danio rerio


Alignment Length:332 Identity:72/332 - (21%)
Similarity:115/332 - (34%) Gaps:67/332 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GLLRMGRIIEELDLLAVWICHLHIHLPNLPEGVPLPYTFITMLVDHAHFLQDKFIADADVSLSGH 177
            |.|.:|::::.:|..|......|...|           .:|..||..:|.....:... |::...
Zfish    44 GELSVGQLLKWMDCTACLSAERHAGCP-----------CVTASVDDIYFEHTIGVGQV-VNIKAK 96

  Fly   178 VSYTDNNFMEVTAYV--------RQSGMLLAKGIFVVEARDAINNGPAPVNPLVPANELEESLHQ 234
            |:...|:.|||...|        |...:..|...||....||   ....:..:||....|:..|.
Zfish    97 VNRAFNSSMEVGIEVSCEDLYRGRHWRVCQAFATFVARRTDA---NKVQLKQVVPCTHQEQLEHS 158

  Fly   235 EAQKRHQERAKALYRLESQQPTKEEQQLMYELFTRTKGDDGPSPSDMT-------TLPPNSRWMS 292
            .|.:|.:.|   |...::.|.....:..........:.:|...|::.|       .|||::    
Zfish   159 LAAERRRMR---LVHHDTMQDLLNNKTFQRSCSEENRDEDAAVPTERTRVESVELVLPPHA---- 216

  Fly   293 TWRRRTLMHPFPENRNESNTIFGGFIIRKAIEISYMTASLYSNQRCMIRFIADVTFAHSIPVHSY 357
                          .::.|| |||.|:.....::.:.||...|....:|.|....|.....|...
Zfish   217 --------------NHQVNT-FGGQIMAWMENVATIAASRLCNAHPTLRAIDMFHFRGPSQVGDR 266

  Fly   358 IKLKAYVVFTHENYIQLLTVVNAIDGNSFTELK-CNVLHLTYSC--SKAVPEILP---------- 409
            :.|||.|..|.:|.:::.....|..|..  .|: .|...:|:..  .|..|..||          
Zfish   267 LILKAIVNNTFKNSMEVGVCAEAYIGEE--PLRHINSAFMTFEVLDDKGRPRPLPLIKPEPKEGQ 329

  Fly   410 RSYHEAL 416
            |.|.|||
Zfish   330 RRYQEAL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13771NP_609061.2 BFIT_BACH 91..220 CDD:239526 24/114 (21%)
BFIT_BACH 289..400 CDD:239526 24/111 (22%)
acot11aXP_005171231.1 BFIT_BACH 22..143 CDD:239526 24/113 (21%)
BFIT_BACH 198..319 CDD:239526 31/141 (22%)
SRPBCC 327..566 CDD:301327 5/10 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.