DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13771 and acot7

DIOPT Version :9

Sequence 1:NP_609061.2 Gene:CG13771 / 33933 FlyBaseID:FBgn0031844 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_005167330.1 Gene:acot7 / 447878 ZFINID:ZDB-GENE-040912-42 Length:359 Species:Danio rerio


Alignment Length:228 Identity:55/228 - (24%)
Similarity:89/228 - (39%) Gaps:54/228 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 REHVGVEGGYHIIPKSRDGLLKFQPKQDELPNR------SMLDSQTTA--QVLLETDALLR---- 105
            ||..|         |.|....|.:..:|::.|.      |:.|.||..  .|:....:|:.    
Zfish   160 REEAG---------KKRYEAQKLERLEDKVRNGEIIMSVSLPDRQTKEPFTVVCSQSSLIHLVGP 215

  Fly   106 -----QRFVYGRGLLRMGRIIEELDLLAVWICHLHIHLPNLPEGVPLPYTFITMLVDHAHFLQDK 165
                 ..||:|...:::  :.|...::|...|..:|               :|..||..:| ..|
Zfish   216 SDCTLHGFVHGGVTMKL--MDEVAGIVAARHCKTNI---------------VTASVDAINF-HRK 262

  Fly   166 FIADADVSLSGHVSYTDNNFMEVTAYVRQSGMLLA-KG-------IFVVEARDAINNGPAPVNPL 222
            ......:::||.:::|.|..||:..:|....::.| ||       .|...:.|. .|.|.||.||
Zfish   263 IKKGCVITVSGRMTFTSNKSMEIEVFVDADPLVEAEKGKYRAVTAFFTYISLDK-ENKPLPVPPL 326

  Fly   223 VPANELEESLHQEAQKRH-QERAKALYRLESQQ 254
            ....|.|:...:|.:.|: |.:||.|...|.||
Zfish   327 KLEGEEEQKRFEEGKARYLQNKAKRLADKERQQ 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13771NP_609061.2 BFIT_BACH 91..220 CDD:239526 31/147 (21%)
BFIT_BACH 289..400 CDD:239526
acot7XP_005167330.1 BFIT_BACH 28..137 CDD:239526
BFIT_BACH 200..324 CDD:239526 29/142 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.