DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13771 and Acot7

DIOPT Version :9

Sequence 1:NP_609061.2 Gene:CG13771 / 33933 FlyBaseID:FBgn0031844 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001139533.1 Gene:Acot7 / 26759 RGDID:628856 Length:381 Species:Rattus norvegicus


Alignment Length:347 Identity:67/347 - (19%)
Similarity:130/347 - (37%) Gaps:63/347 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 VYGRGLLRMGRIIEELDLLAVWICHLHIHLPNLPEGVPLPYTFITMLVDHAHFLQDKFIADADVS 173
            |:|..:|:|   |||..::   |...|.:..|....|.     ....|:...||....|.:. ..
  Rat    72 VHGGTILKM---IEEAGVI---ISTRHCNSQNGERCVA-----ALARVERTDFLSPMCIGEV-AH 124

  Fly   174 LSGHVSYTDNNFMEVTAYVRQSGMLLAKGIFVVEAR-----------DAINNGPAPVNPLVPANE 227
            :|..::||..:.:||..:|....:|........:|.           |.:...|    |:|   .
  Rat   125 VSAEITYTSKHSVEVQVHVLSENILTGTKKLTNKATLWYVPLSLKNVDKVLEVP----PIV---Y 182

  Fly   228 LEESLHQEAQKRHQERAKALYRLESQQPTKEEQQLMYELFTRTKGDDGPSPSDMTTLPPNSRWMS 292
            |.:...:|.:||::  |:.|.|:|                  ||..:|.....:....||:   .
  Rat   183 LRQEQEEEGRKRYE--AQKLERME------------------TKWRNGDIVQPILNPEPNT---V 224

  Fly   293 TWRRRTLMHPF-PENRNESNTIFGGFIIRKAIEISYMTASLYSNQRCMIRFIADVTFAHSIPVHS 356
            ::.:.:|:|.. |.:......:.||..::...|::.:.|:.:.....:...:..:.|...|....
  Rat   225 SYSQSSLIHLVGPSDCTLHGFVHGGVTMKLMDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGC 289

  Fly   357 YIKLKAYVVFTHENYIQLLTVVNA--IDGNSFTELKCNVLHLTY-SCSK-----AVPEILPRSYH 413
            .|.:...:.||....:::..:|:|  :..||....:......|| |.::     .||:::|.:..
  Rat   290 VITISGRMTFTSNKSMEIEVLVDADPVVDNSQKRYRAASAFFTYVSLNQEGKPLPVPQLVPETED 354

  Fly   414 EALWYLTGR-RYFNRFRESVSH 434
            |...:..|: ||.....:...|
  Rat   355 EKKRFEEGKGRYLQMKAKRQGH 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13771NP_609061.2 BFIT_BACH 91..220 CDD:239526 25/121 (21%)
BFIT_BACH 289..400 CDD:239526 18/114 (16%)
Acot7NP_001139533.1 BFIT_BACH 59..164 CDD:239526 23/103 (22%)
NINJA_B 183..>208 CDD:292754 10/44 (23%)
BFIT_BACH 223..346 CDD:239526 19/125 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 343..381 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.