DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13771 and ACOT11

DIOPT Version :9

Sequence 1:NP_609061.2 Gene:CG13771 / 33933 FlyBaseID:FBgn0031844 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_056362.1 Gene:ACOT11 / 26027 HGNCID:18156 Length:607 Species:Homo sapiens


Alignment Length:362 Identity:67/362 - (18%)
Similarity:111/362 - (30%) Gaps:128/362 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RGLLRMGRIIEELDLLAVWICHLHIHLPNLPEGVPLPYTFITMLVDHAHFLQDKFIADADVSLSG 176
            ||.|.:|::::.:|..|......|...|           .:|..:|..:|.....:... |::..
Human    61 RGELSVGQLLKWIDTTACLSAERHAGCP-----------CVTASMDDIYFEHTISVGQV-VNIKA 113

  Fly   177 HVSYTDNNFMEVTAYVRQSGML------LAKGIFVVEARDAINNGPAPVNPLVPANELEESLHQE 235
            .|:...|:.|||...|....:.      :.|.:....||..|..  ..:..:.|..|.|:..|..
Human   114 KVNRAFNSSMEVGIQVASEDLCSEKQWNVCKALATFVARREITK--VKLKQITPRTEEEKMEHSV 176

  Fly   236 AQKRHQERAKALYR---------------LESQQ-----PTKEEQQLMYELFTRTKGDDGPSPSD 280
            |.:|  .|.:.:|.               |||:.     |.::.:....||              
Human   177 AAER--RRMRLVYADTIKDLLANCAIQGDLESRDCSRMVPAEKTRVESVEL-------------- 225

  Fly   281 MTTLPPNSRWMSTWRRRTLMHPFPENRNESNTIFGGFIIR--------------------KAIEI 325
              .|||::                   |.....|||.|:.                    ||||:
Human   226 --VLPPHA-------------------NHQGNTFGGQIMAWMENVATIAASRLCRAHPTLKAIEM 269

  Fly   326 SYMTASLYSNQRCMIRFIADVTFAHSIPVHSYIKLKAYVVFTHENYIQLLTVVNAIDGNSFTELK 390
            .:.........|.:::.|.:..|.||:.|...::.......||..:|                  
Human   270 FHFRGPSQVGDRLVLKAIVNNAFKHSMEVGVCVEAYRQEAETHRRHI------------------ 316

  Fly   391 CNVLHLTYSCSKA--VPEILP----------RSYHEA 415
             |...:|:....|  .|::||          |.|.||
Human   317 -NSAFMTFVVLDADDQPQLLPWIRPQPGDGERRYREA 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13771NP_609061.2 BFIT_BACH 91..220 CDD:239526 22/113 (19%)
BFIT_BACH 289..400 CDD:239526 20/130 (15%)
ACOT11NP_056362.1 BFIT_BACH 43..157 CDD:239526 22/107 (21%)
Coenzyme A binding. /evidence=ECO:0000250 91..93 1/1 (100%)
Coenzyme A binding. /evidence=ECO:0000250 120..122 1/1 (100%)
BFIT_BACH 213..336 CDD:239526 28/176 (16%)
Coenzyme A binding. /evidence=ECO:0000250 271..273 0/1 (0%)
START_STARD14-like 344..583 CDD:176921 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.