DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13771 and T22B7.7

DIOPT Version :9

Sequence 1:NP_609061.2 Gene:CG13771 / 33933 FlyBaseID:FBgn0031844 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001362037.1 Gene:T22B7.7 / 180832 WormBaseID:WBGene00020674 Length:393 Species:Caenorhabditis elegans


Alignment Length:354 Identity:87/354 - (24%)
Similarity:148/354 - (41%) Gaps:52/354 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LPNRSMLDSQTTAQVLLETDALLRQRFVYGRGLLRMGRIIEELDLLAVWICHL----HIHLPNLP 142
            |.:|.|.:|:....:.|.||...|.......|.:||||::|.:|::|...|::    .|.|....
 Worm    65 LESRKMAESELKVVIPLATDFKARLNMTDSYGHIRMGRLLEAIDIVAPCACYMLNREDIALRTFE 129

  Fly   143 EGVPLPYTFIT-----MLVDHAHFLQDKFIADADVSLSGHVSYTDNNFMEVTAYVRQ--SGMLLA 200
            .|. ||..|:|     ..:.|.:.|...    .|:.|.|.|::|..|..|.|..|.|  |..|.|
 Worm   130 TGT-LPRMFVTARFHQTSLSHGYGLSPY----RDIILRGKVTWTSENKAEATVNVIQNKSEFLTA 189

  Fly   201 KGIFVVEARDAINNG-PAPVNPLVPANELEESLHQEAQKRHQERAKALYRLESQQPTKEEQQLMY 264
            :.:|.  :.|..|.. ..|.|.|:|:..:|..|:|:   ||:              ....:..:.
 Worm   190 RLVFA--SLDGTNTSQKLPTNQLLPSTPIENFLNQQ---RHE--------------ANTSRPCIP 235

  Fly   265 ELFTRTKGDDGPSPSDMTTLPPNSRWMSTWRRRTLMHPFPENRNESNTIFGGFIIRKAIEISYMT 329
            ||.|          .::..:......|::....|.....||:.|...::||||::||.:|.:.:.
 Worm   236 ELGT----------IELPVIKDGEVTMNSTNVETTTIAQPEHENPYGSVFGGFLVRKGLETAELC 290

  Fly   330 ASLYSNQRCMIRFIADVTFAHSIPVHSYIKLKAYV--VFTHENYIQLLTVVNAIDGNSFTELKCN 392
            |.::|.....:..|.|..|...:.:.|.:|..|:|  |...|...|:.:.|...:.|:.....|:
 Worm   291 AKMFSKTSVRVSSIDDAEFMKVVEIGSILKFSAFVCNVDNKEQKFQVNSQVEVYNSNTNKFEICD 355

  Fly   393 VLHLTYSCSKAV--PEILPRSYHE--ALW 417
            ....|:...:.:  |:::|.:..|  |.|
 Worm   356 RFLFTFEAKEEINLPQVIPHNMQEFVAQW 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13771NP_609061.2 BFIT_BACH 91..220 CDD:239526 39/140 (28%)
BFIT_BACH 289..400 CDD:239526 28/112 (25%)
T22B7.7NP_001362037.1 PLN02647 58..367 CDD:215349 82/335 (24%)
BFIT_BACH 250..374 CDD:239526 29/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162220
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55517
OrthoDB 1 1.010 - - D786592at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12655
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.