DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13771 and acot12

DIOPT Version :9

Sequence 1:NP_609061.2 Gene:CG13771 / 33933 FlyBaseID:FBgn0031844 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_003199439.2 Gene:acot12 / 100536873 -ID:- Length:570 Species:Danio rerio


Alignment Length:392 Identity:74/392 - (18%)
Similarity:124/392 - (31%) Gaps:137/392 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RGLLRMGRIIEELDLLAVWICHLHIHLPNLPEGVPLPYTFITMLVDHAHFLQDKFIADADVSLSG 176
            :|.|..|::::.:|..|......|..:           ..:|..:|...|.:...:... :|:..
Zfish    37 QGELGAGQLLKWMDTTACLAAERHAGM-----------ACVTASMDDIQFEETVRVGQV-ISIKS 89

  Fly   177 HVSYTDNNFMEVTAYVR----QSGML----LAKGIFVVEARDAINNGPAPVN--PLVPANELEES 231
            .|:...|..|||..||.    .||::    :|...||.:.     .|...|:  ||.....:||.
Zfish    90 RVNRAFNTSMEVGIYVTVQEVLSGVMKRVCVAFSTFVAKP-----TGTQKVSLKPLDVQGSVEEM 149

  Fly   232 L-HQEAQKRHQERA------------------KALYRLESQQPTKEEQQLMYELFTRTKGDDGPS 277
            | |..|.:|.:.|.                  |.|||.:...|....:      .||.:      
Zfish   150 LEHSLASERRRLRLYNEEAFNNLMKDYYNLQDKGLYRGKPVTPAVSTE------LTRVE------ 202

  Fly   278 PSDMTTLPPNSRWMSTWRRRTLMHPFPENRNESNTIFGGFIIRKAIEISYMTAS----------- 331
             |....|||::                   |.....|||.|:.....::.:.||           
Zfish   203 -SIELVLPPHA-------------------NHHGNTFGGQIMAWMENVATVAASRLCGYYPSLGA 247

  Fly   332 ---------LYSNQRCMIRFIADVTFAHSIPVHSYIKLKAYVVFTHENYIQLLTVVNAIDGNSFT 387
                     .:...|.:.:.:.:.||.:|:.|.  ::::||               |..:.|..|
Zfish   248 VDMFRFRGPSFVGDRLVFKAMVNNTFQNSVEVG--VRVEAY---------------NCEEWNEGT 295

  Fly   388 ELKCNVLHLTYSCSKAVPE------ILPRSYHEALWYLTGRRYF---------NRFRESVSHDMD 437
            ....|...:.|    .:||      :||...:..   |.|.|.|         ...|:.:.:..|
Zfish   296 PRHINSASMMY----YIPERDGERRMLPDVTYTT---LDGERRFIGAIVRKRIRMARKHILYSRD 353

  Fly   438 NG 439
            .|
Zfish   354 EG 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13771NP_609061.2 BFIT_BACH 91..220 CDD:239526 23/115 (20%)
BFIT_BACH 289..400 CDD:239526 19/130 (15%)
acot12XP_003199439.2 BFIT_BACH 20..137 CDD:239526 24/116 (21%)
BFIT_BACH 194..319 CDD:239526 27/177 (15%)
SRPBCC 330..562 CDD:301327 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.