DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13771 and Acot11

DIOPT Version :9

Sequence 1:NP_609061.2 Gene:CG13771 / 33933 FlyBaseID:FBgn0031844 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001258312.1 Gene:Acot11 / 100363074 RGDID:2324815 Length:594 Species:Rattus norvegicus


Alignment Length:281 Identity:58/281 - (20%)
Similarity:102/281 - (36%) Gaps:66/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RGLLRMGRIIEELDLLAVWICHLHIHLPNLPEGVPLPYTFITMLVDHAHFLQDKFIADAD-VSLS 175
            ||.|.:|::::.:|..|......|...|           .:|..:|..:|  |..|:... |::.
  Rat    63 RGELSIGQLLKWIDTTACLSAERHAGCP-----------CVTASMDDIYF--DHTISVGQVVNIK 114

  Fly   176 GHVSYTDNNFMEVTAYV--------RQSGMLLAKGIFVVEARDAINNGPAPVNPLVPANELEESL 232
            ..|:...|:.|||...|        :|..:..|...||.. |:.   ....:..:||..|.|::.
  Rat   115 AKVNRAFNSSMEVGIQVVSEDLCSEKQWSVCKALATFVAH-REL---SKVKLKQVVPLTEEEKTE 175

  Fly   233 HQEAQKRHQERAKALYRLESQQPTKEEQQLMYELFTRTKGDDGPSPSDMTTLPPNSRWMSTWRRR 297
            |..|.:|  .|.:.:|       |...:.|:.....:...|     .|.:.:.|..:    .|..
  Rat   176 HGVAAER--RRMRLVY-------TDTIKDLLAHYAIQDDLD-----KDCSNMVPAEK----TRVE 222

  Fly   298 TLMHPFPENRNESNTIFGGFIIR--------------------KAIEISYMTASLYSNQRCMIRF 342
            ::....|.:.|.....|||.|:.                    ||||:.:.........|.:::.
  Rat   223 SVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCHAHPTLKAIEMFHFRGPSQVGDRLVLKA 287

  Fly   343 IADVTFAHSIPVHSYIKLKAY 363
            |.:..|.||:.|.  :.::||
  Rat   288 IVNNAFKHSMEVG--VCVEAY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13771NP_609061.2 BFIT_BACH 91..220 CDD:239526 25/116 (22%)
BFIT_BACH 289..400 CDD:239526 19/95 (20%)
Acot11NP_001258312.1 BFIT_BACH 45..153 CDD:239526 23/102 (23%)
BFIT_BACH 214..337 CDD:239526 20/99 (20%)
SRPBCC 345..583 CDD:301327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.