DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11070 and CG2218

DIOPT Version :9

Sequence 1:NP_609060.1 Gene:CG11070 / 33932 FlyBaseID:FBgn0028467 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_001287613.1 Gene:CG2218 / 43611 FlyBaseID:FBgn0039767 Length:486 Species:Drosophila melanogaster


Alignment Length:79 Identity:32/79 - (40%)
Similarity:40/79 - (50%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   916 PEEYLDPIISTLMTDPVVLPSSKVTVDRSTIARHLLSD------QTDPF-NREPLTMDKVKSNEA 973
            |||:||.|...||..|.||||.|| ||:|||.:|...:      .:||| ..|.....|...:.|
  Fly   223 PEEFLDSITWELMIFPTVLPSGKV-VDQSTIDKHAEEEAKWGRQPSDPFTGLEFNAQRKAILHLA 286

  Fly   974 LKQEIESWIQGKRE 987
            ||..||.::....|
  Fly   287 LKARIEKFLMENSE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11070NP_609060.1 Ufd2P_core 251..898 CDD:287392
U-box 915..987 CDD:252675 31/77 (40%)
CG2218NP_001287613.1 U-box 222..300 CDD:252675 31/77 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5113
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.