DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11070 and ubox5

DIOPT Version :9

Sequence 1:NP_609060.1 Gene:CG11070 / 33932 FlyBaseID:FBgn0028467 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_001314991.1 Gene:ubox5 / 402829 ZFINID:ZDB-GENE-110411-166 Length:477 Species:Danio rerio


Alignment Length:304 Identity:65/304 - (21%)
Similarity:94/304 - (30%) Gaps:101/304 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   752 LPHTEREQHMTNLQHLGMLARFDNIIGRDTINLLKLLTSKIKSIFCHNSMVDRMAAMLNYFL--- 813
            |||.:...|...|          ...|.|..|||.           .:..|.|....|.|||   
Zfish     7 LPHFQTSIHCNKL----------CADGYDVSNLLS-----------EDLNVRRRGFKLEYFLRPP 50

  Fly   814 ----LNL-------------------VGPKKERFKVKDKKEFEFDPAQTV--------IEISHIY 847
                ||.                   .|....|.::....|...:..|.|        |.:|..:
Zfish    51 VHVTLNFQVQMEVCRLDVELWPWGMDQGRSSRRIEILTSSEKSGENFQLVSRCDLKEEIHLSFTH 115

  Fly   848 INLSSDESFC----LAVSQDGRSYSEQLFSYAENILIRI---GGGQLIGDMSEFAVKVARMGAQY 905
            ....|...||    ..|.:....:|.:..|....:.|.|   |....:|..|   :.:..:.::.
Zfish   116 PFFKSRPPFCDPPPPFVGESKEFWSPRSLSSVAQLRISIPYSGAASALGFRS---LSIWALPSRC 177

  Fly   906 KEEQELL----------------------------ADAPEEYLDPIISTLMTDPVVLPSSKVTVD 942
            ..|.||.                            :..|||:|||:...||..|::|||..: :|
Zfish   178 CSESELKKIHQAHLNTLKINPTTPIATKSESFQTDSPTPEEFLDPLTQELMVLPMILPSGMI-ID 241

  Fly   943 RSTIARHLLSDQT------DPFNREPLT-MDKVKSNEALKQEIE 979
            :||:..:...:.|      |||...|.| ..|...|..||..|:
Zfish   242 QSTLEEYEKREATWGRLPNDPFTGVPFTPSSKPLPNPLLKSRID 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11070NP_609060.1 Ufd2P_core 251..898 CDD:287392 36/186 (19%)
U-box 915..987 CDD:252675 26/72 (36%)
ubox5NP_001314991.1 RING 216..290 CDD:302633 26/71 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5113
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.