Sequence 1: | NP_609060.1 | Gene: | CG11070 / 33932 | FlyBaseID: | FBgn0028467 | Length: | 993 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001314991.1 | Gene: | ubox5 / 402829 | ZFINID: | ZDB-GENE-110411-166 | Length: | 477 | Species: | Danio rerio |
Alignment Length: | 304 | Identity: | 65/304 - (21%) |
---|---|---|---|
Similarity: | 94/304 - (30%) | Gaps: | 101/304 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 752 LPHTEREQHMTNLQHLGMLARFDNIIGRDTINLLKLLTSKIKSIFCHNSMVDRMAAMLNYFL--- 813
Fly 814 ----LNL-------------------VGPKKERFKVKDKKEFEFDPAQTV--------IEISHIY 847
Fly 848 INLSSDESFC----LAVSQDGRSYSEQLFSYAENILIRI---GGGQLIGDMSEFAVKVARMGAQY 905
Fly 906 KEEQELL----------------------------ADAPEEYLDPIISTLMTDPVVLPSSKVTVD 942
Fly 943 RSTIARHLLSDQT------DPFNREPLT-MDKVKSNEALKQEIE 979 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11070 | NP_609060.1 | Ufd2P_core | 251..898 | CDD:287392 | 36/186 (19%) |
U-box | 915..987 | CDD:252675 | 26/72 (36%) | ||
ubox5 | NP_001314991.1 | RING | 216..290 | CDD:302633 | 26/71 (37%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5113 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |