DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango1 and mia

DIOPT Version :9

Sequence 1:NP_609058.2 Gene:Tango1 / 33930 FlyBaseID:FBgn0286898 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_001122226.1 Gene:mia / 569807 ZFINID:ZDB-GENE-081022-66 Length:132 Species:Danio rerio


Alignment Length:45 Identity:18/45 - (40%)
Similarity:22/45 - (48%) Gaps:6/45 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLICC--LPTLTWAA----TLSDKRLCADPKCEQIISMGIAKITY 61
            ||:.|  ||....|.    .||||:||||.:|...|.:..|...|
Zfish    11 LLVLCGFLPLAIQAGRHMPKLSDKKLCADSECSHPILIAKALQDY 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango1NP_609058.2 SH3 42..113 CDD:302595 8/20 (40%)
GBP_C <495..585 CDD:303769
PKK 496..606 CDD:289257
coiled coil 560..571 CDD:293879
Drf_FH1 <1291..1337 CDD:283903
miaNP_001122226.1 SH3 34..131 CDD:302595 9/22 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594694
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.