DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and FCRLA

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001171795.2 Gene:FCRLA / 84824 HGNCID:18504 Length:365 Species:Homo sapiens


Alignment Length:277 Identity:58/277 - (20%)
Similarity:93/277 - (33%) Gaps:70/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMC 113
            ||....|...||:.          |..:..|.|:.   |..|||.        |:.::....:..
Human    25 LLAAGCHAAASFET----------LQCEGPVCTEE---SSCHTED--------DLTDAREAGFQV 68

  Fly   114 QINT--DPMKSQMGYLDVVVPPDIVDYQTSQDVVRST--GQNVTLTCSA-TGVPMPTITWRREEA 173
            :..|  :|....:.|          |:...|...:..  |..:.|.|.| ...|:..:|:.|:.:
Human    69 KAYTFSEPFHLIVSY----------DWLILQGPAKPVFEGDLLVLRCQAWQDWPLTQVTFYRDGS 123

  Fly   174 TPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIA-----SNGVPPTVSKRVMLVVNFAPT- 232
            .   :...|....||:.       .||::..|.|.|..     ..|:|.|.|...:.|....|. 
Human   124 A---LGPPGPNREFSIT-------VVQKADSGHYHCSGIFQSPGPGIPETASVVAITVQELFPAP 178

  Fly   233 IWTRYDTIYVGLGQKLTLECIT----ESQPASVNF-WLRDSQLLQGGSYESVSVDHVFRIVMRIT 292
            |.....:.....|..:||.|.|    :...|.:.| :.:|.:::|     |..:...|:|     
Human   179 ILRAVPSAEPQAGSPMTLSCQTKLPLQRSAARLLFSFYKDGRIVQ-----SRGLSSEFQI----- 233

  Fly   293 LRPITKRDF-GEYICRA 308
              |....|. |.|.|.|
Human   234 --PTASEDHSGSYWCEA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 15/77 (19%)
Ig 39..122 CDD:299845 15/74 (20%)
Ig 132..213 CDD:299845 17/88 (19%)
IG_like 141..227 CDD:214653 20/93 (22%)
IG_like 239..322 CDD:214653 18/76 (24%)
IGc2 245..313 CDD:197706 18/70 (26%)
FCRLANP_001171795.2 Ig 85..152 CDD:353325 16/76 (21%)
Ig_2 177..266 CDD:316418 19/84 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.