DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and opcml

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001072487.1 Gene:opcml / 779942 XenbaseID:XB-GENE-5831850 Length:346 Species:Xenopus tropicalis


Alignment Length:320 Identity:94/320 - (29%)
Similarity:151/320 - (47%) Gaps:34/320 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LNNSDPKFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISH 90
            :.:.|..|...::|.||..|..|:|.|.|.:.|: :||||  :..|||...|...:.:.|:.:..
 Frog    33 VRSGDAGFPKAMDNVTVRQGDSAILRCTVDNRVT-RVAWL--NRSTILYTGNDKWSIDPRVVLLA 94

  Fly    91 TEHRIWQLKIRDVQESDRGWYMCQINTD--PMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVT 153
            .....:.::|::|...|.|.|.|.:.||  |..|:: :|.|.|.|.|::  .|.|:..:.|..|.
 Frog    95 NTKSQYSIEIQNVDIYDEGPYTCSVQTDNHPKTSRV-HLIVQVAPQILN--ISSDITVNEGSTVA 156

  Fly   154 LTCSATGVPMPTITWRR-EEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPP 217
            |.|.|||.|.|.:|||. ...:...:|||   |...:.|       :.|...|.|.|.|:|.|..
 Frog   157 LRCLATGRPEPAVTWRHFTGKSHRFVSDD---EYLEITG-------ITRDQSGQYECSAANDVSA 211

  Fly   218 TVSKRVMLVVNFAPTIWTRYDTIYVG--LGQKLTLECITESQPASVNFWLRDSQLLQGGSYESVS 280
            ...::|.:.||:.|.|   .||...|  ||||..|.|...:.|.:...|.|:...|..| .:.|.
 Frog   212 PDIRKVRVTVNYPPYI---SDTRNTGASLGQKGILRCSASAVPLAEFQWYREETRLANG-LDGVR 272

  Fly   281 V---DHVFRIVMRITLRPITKRDFGEYICRAKNAMGQTDRIITVHHKAKKHGQHSHQTSS 337
            :   ||    :..:|...::::|:|.|.|.|.|.:|.::..:.::  |.....|:..:|:
 Frog   273 IENKDH----MSILTFFNVSEKDYGNYTCVASNKLGNSNASVILY--AGPGAIHNRSSSA 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 28/87 (32%)
Ig 39..122 CDD:299845 27/84 (32%)
Ig 132..213 CDD:299845 26/81 (32%)
IG_like 141..227 CDD:214653 27/86 (31%)
IG_like 239..322 CDD:214653 24/87 (28%)
IGc2 245..313 CDD:197706 20/70 (29%)
opcmlNP_001072487.1 Ig 46..134 CDD:325142 29/91 (32%)
Ig_3 138..207 CDD:316449 26/80 (33%)
ig 228..312 CDD:278476 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4412
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.