DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and Kirrel3

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus


Alignment Length:357 Identity:76/357 - (21%)
Similarity:147/357 - (41%) Gaps:54/357 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVIT--KNHRISISHTEHRIWQLKIR 101
            |..:|.|::   |.|..|:....:..|.|:.|.:|  :::::|  .:.:.:.:.|::| |..:..
Mouse   231 NKAIPGGKE---TSVTIDIQHPPLVNLSVEPQPVL--EDNIVTFHCSAKANPAVTQYR-WAKRGH 289

  Fly   102 DVQESDRGWYMCQIN----TDPMKSQM----------GYLDVVVPPDIVDYQTSQDVVRSTGQNV 152
            .::|:....|...::    ::|:..::          ..:||...|.:.  ...|.::...|.:.
Mouse   290 IIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMT--SEPQSLLVDLGSDA 352

  Fly   153 TLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPP 217
            ..:|:..|.|..||.|.:..:..:|.::           :.|||..|::...|.|:|.|   |.|
Mouse   353 VFSCAWIGNPSLTIVWMKRGSGVVLSNE-----------KTLTLKSVRQEDAGKYVCRA---VVP 403

  Fly   218 TV---SKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITESQPASVNF-WLRDSQLLQGGS--- 275
            .|   .:.|.|.|| .|.|.:...|.:...|:|..::|...|.|..... |.....:|:.|:   
Mouse   404 RVGAGEREVTLTVN-GPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGR 467

  Fly   276 YESVSVDHVFRIVMRITLRPITKRDFGE-YICRAKNAMGQTDRIITVHHKAKKHGQHSHQTSSRE 339
            |...:|:....::..:|:..|.:.||.. |.|.|.|:.|....||    :.|:.|......:..|
Mouse   468 YTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEII----RLKEQGSEMKSGAGLE 528

  Fly   340 SQFIVIEEYIANMSDKSCSFQPLW---IMFLC 368
            ::.:.:...|........:|..|.   :.|.|
Mouse   529 AESVPMAVIIGVAVGAGVAFLVLMATIVAFCC 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 17/101 (17%)
Ig 39..122 CDD:299845 17/88 (19%)
Ig 132..213 CDD:299845 18/80 (23%)
IG_like 141..227 CDD:214653 22/88 (25%)
IG_like 239..322 CDD:214653 22/87 (25%)
IGc2 245..313 CDD:197706 18/72 (25%)
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653
Ig strand A' 56..60 CDD:409353
Ig strand B 64..71 CDD:409353
Ig strand C 78..82 CDD:409353
Ig strand C' 84..87 CDD:409353
Ig strand D 97..101 CDD:409353
Ig strand E 104..116 CDD:409353
Ig strand G 132..143 CDD:409353
IgI_2_KIRREL3-like 149..246 CDD:409416 5/17 (29%)
Ig strand B 166..170 CDD:409416
Ig strand C 180..184 CDD:409416
Ig strand E 210..214 CDD:409416
Ig strand F 224..229 CDD:409416
Ig strand G 239..242 CDD:409416 1/5 (20%)
Ig <267..334 CDD:416386 9/67 (13%)
Ig strand B 267..274 CDD:409353 1/6 (17%)
Ig strand C 279..286 CDD:409353 3/7 (43%)
Ig strand C' 288..291 CDD:409353 0/2 (0%)
Ig strand D 298..302 CDD:409353 1/3 (33%)
Ig strand E 304..310 CDD:409353 0/5 (0%)
Ig strand G 321..334 CDD:409353 2/12 (17%)
Ig 335..416 CDD:416386 23/96 (24%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 1/9 (11%)
Ig strand C 365..371 CDD:409353 3/5 (60%)
Ig strand E 381..387 CDD:409353 3/5 (60%)
IgI_5_KIRREL3 418..515 CDD:409479 24/100 (24%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 0/3 (0%)
Ig strand E 481..485 CDD:409479 0/3 (0%)
Ig strand F 496..501 CDD:409479 2/4 (50%)
Ig strand G 509..512 CDD:409479 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.