DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and CG34353

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:393 Identity:104/393 - (26%)
Similarity:173/393 - (44%) Gaps:62/393 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RRLPS-----FWLLLLQSVCFSQASF-SELNNSDPKFSGPINNSTVPVGRDALLTCVVHDLVSFK 61
            ||:.|     |..:.:.|:.|...|. |.:..::|.|...........|...:|.|.|.:..::.
  Fly    52 RRVGSLPHILFLAIAVVSLHFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYV 116

  Fly    62 VAWLRVDTQTILSIQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGY 126
            |||.|  ...||:..:..:|.:.|:.:.:.    :.|:|||...:|.|.|:|||.|...:.....
  Fly   117 VAWKR--GIAILTAGSVKVTPDPRVRLVNG----FNLQIRDALPTDAGDYICQIATMDPREITHT 175

  Fly   127 LDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEG 191
            ::::|||.|....|...:....|.:|.:.|||||.|||.:||.|:..    |..:|:.::.|   
  Fly   176 VEILVPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSRKNN----ILPNGEEKLHS--- 233

  Fly   192 QNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECIT-- 254
            ..|::..|.|...|.|:|.|:|.|....|.:|:|.|.|:|.|......::.|.|.:.||.||.  
  Fly   234 HVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHG 298

  Fly   255 ESQPASVNFWLRDSQLLQGGSYESVSVDHVFRIVMR-------ITLRPITKRDFGEYICRAKNAM 312
            |:||..:  |.:|          ::.:|...|.:|.       :.:|.:..:|||.|.|.|:|.:
  Fly   299 ETQPEVI--WFKD----------TMQLDTTERHIMETRGSRHTLIIRKVHPQDFGNYSCVAENQL 351

  Fly   313 GQTDRIITVHHKAKKHGQHSHQTSSRESQFIV---------IEEY-------------IANMSDK 355
            |:..:.:.:..|......:|...|..:.::.:         ||||             :.|..|.
  Fly   352 GKARKTLQLSGKPNVAVFNSPPISQYKDRYNISWAVDSHSPIEEYKLSFRKLPQGHEVVGNAIDS 416

  Fly   356 SCS 358
            |.|
  Fly   417 SSS 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 23/85 (27%)
Ig 39..122 CDD:299845 23/82 (28%)
Ig 132..213 CDD:299845 27/80 (34%)
IG_like 141..227 CDD:214653 28/85 (33%)
IG_like 239..322 CDD:214653 23/91 (25%)
IGc2 245..313 CDD:197706 21/76 (28%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 23/85 (27%)
Ig 103..177 CDD:143165 22/79 (28%)
IG_like 191..269 CDD:214653 28/84 (33%)
IGc2 198..258 CDD:197706 24/66 (36%)
I-set 273..360 CDD:254352 25/98 (26%)
Ig 290..359 CDD:143165 21/80 (26%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
32.810

Return to query results.
Submit another query.