DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and CG34353

DIOPT Version :10

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:393 Identity:104/393 - (26%)
Similarity:173/393 - (44%) Gaps:62/393 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RRLPS-----FWLLLLQSVCFSQASF-SELNNSDPKFSGPINNSTVPVGRDALLTCVVHDLVSFK 61
            ||:.|     |..:.:.|:.|...|. |.:..::|.|...........|...:|.|.|.:..::.
  Fly    52 RRVGSLPHILFLAIAVVSLHFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYV 116

  Fly    62 VAWLRVDTQTILSIQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGY 126
            |||.|  ...||:..:..:|.:.|:.:.:.    :.|:|||...:|.|.|:|||.|...:.....
  Fly   117 VAWKR--GIAILTAGSVKVTPDPRVRLVNG----FNLQIRDALPTDAGDYICQIATMDPREITHT 175

  Fly   127 LDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEG 191
            ::::|||.|....|...:....|.:|.:.|||||.|||.:||.|:..    |..:|:.::.|   
  Fly   176 VEILVPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSRKNN----ILPNGEEKLHS--- 233

  Fly   192 QNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECIT-- 254
            ..|::..|.|...|.|:|.|:|.|....|.:|:|.|.|:|.|......::.|.|.:.||.||.  
  Fly   234 HVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHG 298

  Fly   255 ESQPASVNFWLRDSQLLQGGSYESVSVDHVFRIVMR-------ITLRPITKRDFGEYICRAKNAM 312
            |:||..:  |.:|          ::.:|...|.:|.       :.:|.:..:|||.|.|.|:|.:
  Fly   299 ETQPEVI--WFKD----------TMQLDTTERHIMETRGSRHTLIIRKVHPQDFGNYSCVAENQL 351

  Fly   313 GQTDRIITVHHKAKKHGQHSHQTSSRESQFIV---------IEEY-------------IANMSDK 355
            |:..:.:.:..|......:|...|..:.::.:         ||||             :.|..|.
  Fly   352 GKARKTLQLSGKPNVAVFNSPPISQYKDRYNISWAVDSHSPIEEYKLSFRKLPQGHEVVGNAIDS 416

  Fly   356 SCS 358
            |.|
  Fly   417 SSS 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 23/85 (27%)
Ig strand B 48..52 CDD:143290 1/3 (33%)
Ig strand C 61..65 CDD:143290 2/3 (67%)
Ig strand E 96..100 CDD:143290 1/3 (33%)
Ig strand F 110..115 CDD:143290 2/4 (50%)
Ig 133..227 CDD:472250 31/93 (33%)
Ig strand B 152..156 CDD:409562 1/3 (33%)
Ig strand C 165..169 CDD:409562 1/3 (33%)
Ig strand E 192..196 CDD:409562 1/3 (33%)
Ig strand F 206..211 CDD:409562 2/4 (50%)
Ig strand G 220..223 CDD:409562 1/2 (50%)
Ig_3 231..310 CDD:464046 23/87 (26%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 23/85 (27%)
Ig strand B 103..107 CDD:409353 1/3 (33%)
Ig strand C 116..120 CDD:409353 2/3 (67%)
Ig strand E 145..149 CDD:409353 1/3 (33%)
Ig strand F 159..164 CDD:409353 2/4 (50%)
Ig strand G 173..176 CDD:409353 0/2 (0%)
Ig 182..269 CDD:472250 31/93 (33%)
Ig strand B 201..205 CDD:409353 1/3 (33%)
Ig strand C 214..218 CDD:409353 1/3 (33%)
Ig strand F 248..253 CDD:409353 2/4 (50%)
Ig strand G 262..265 CDD:409353 1/2 (50%)
Ig_3 273..349 CDD:464046 23/87 (26%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.