DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and hmcn2

DIOPT Version :10

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_001920501.5 Gene:hmcn2 / 565032 ZFINID:ZDB-GENE-030131-9765 Length:4212 Species:Danio rerio


Alignment Length:302 Identity:80/302 - (26%)
Similarity:135/302 - (44%) Gaps:42/302 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PKFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEHRI 95
            |:........|..||...:|.|..:.:...:|.|.|...|         :...:.:.|...    
Zfish  2025 PRLESESEVRTPLVGSTLILRCEANGIPKPEVTWYRNGLQ---------LAAGNGLRIERQ---- 2076

  Fly    96 WQLKIRDVQESDRGWYMCQINTDPMKSQMGYLD------VVVPPDIVDYQTSQDVVRSTGQNVTL 154
             ||:|..||.:|.|.|.|:::     :..|.:|      |.||| :::....:.:.::.|.::||
Zfish  2077 -QLEIVGVQVADGGVYTCKVS-----NIAGQVDRTFRVTVHVPP-VMEGPLHETLTQNLGSHITL 2134

  Fly   155 TCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTV 219
            .|.|:|:|:|.|.|.: :.:||..|...:   :|.....|.|..:|.||.|.|.|||.|....| 
Zfish  2135 ICEASGIPVPNIAWLK-DGSPIESSLQWN---WSTRANRLELGPLQLSHAGTYTCIAKNTEGQT- 2194

  Fly   220 SKRVMLVVNFAPTIWTRYDT-----IYVGLGQKLTLECITESQPASVNFWLRDSQLLQGGSYESV 279
            .|...|.:...|:|   .|:     :...:|::|.|||.....||....|||:.:.|..|:.|.:
Zfish  2195 QKDYSLTIYAPPSI---IDSGHPSEVSAPVGEELALECRAMGSPAPKVSWLRNGKTLVNGNTEHI 2256

  Fly   280 SVDHVFRIVMRITLRPITKRDFGEYICRAKNAMGQTDRIITV 321
            ::......:..::::|   .|.|.|.|.|.::.||..:|.|:
Zfish  2257 NISPDGSTLTFLSVKP---EDSGTYTCLAVSSAGQETKIYTL 2295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 19/85 (22%)
Ig strand B 48..52 CDD:143290 1/3 (33%)
Ig strand C 61..65 CDD:143290 1/3 (33%)
Ig strand E 96..100 CDD:143290 2/3 (67%)
Ig strand F 110..115 CDD:143290 2/4 (50%)
Ig 133..227 CDD:472250 29/93 (31%)
Ig strand B 152..156 CDD:409562 2/3 (67%)
Ig strand C 165..169 CDD:409562 1/3 (33%)
Ig strand E 192..196 CDD:409562 1/3 (33%)
Ig strand F 206..211 CDD:409562 2/4 (50%)
Ig strand G 220..223 CDD:409562 1/2 (50%)
Ig_3 231..310 CDD:464046 22/83 (27%)
hmcn2XP_001920501.5 Ig strand F 1221..1226 CDD:409570
Ig strand G 1234..1237 CDD:409570
Ig 1245..1335 CDD:472250
Ig strand B 1263..1267 CDD:409570
Ig strand C 1276..1280 CDD:409570
Ig strand E 1301..1305 CDD:409570
Ig strand F 1315..1320 CDD:409570
Ig strand G 1328..1331 CDD:409570
Ig 1338..1430 CDD:472250
Ig strand B 1358..1362 CDD:409353
Ig strand C 1371..1375 CDD:409353
Ig strand E 1394..1398 CDD:409353
Ig strand F 1408..1413 CDD:409353
Ig strand G 1421..1424 CDD:409353
I-set 1443..1523 CDD:400151
Ig strand B 1451..1455 CDD:409353
Ig strand C 1464..1468 CDD:409353
Ig strand E 1488..1493 CDD:409353
Ig strand F 1503..1508 CDD:409353
I-set 1538..1608 CDD:400151
Ig strand B 1546..1550 CDD:409353
Ig strand C 1559..1563 CDD:409353
Ig strand E 1582..1586 CDD:409353
Ig strand F 1596..1601 CDD:409353
Ig strand G 1610..1613 CDD:409353
ChlD <21..206 CDD:440853
IG_like 441..512 CDD:214653
Ig 516..603 CDD:472250
Ig strand B 533..537 CDD:409353
Ig strand C 546..550 CDD:409353
Ig strand E 569..573 CDD:409353
Ig strand F 583..588 CDD:409353
Ig strand G 596..599 CDD:409353
Ig_3 607..680 CDD:464046
I-set 711..784 CDD:400151
Ig strand B 714..718 CDD:409353
Ig strand C 727..731 CDD:409353
Ig strand E 750..754 CDD:409353
Ig strand F 764..769 CDD:409353
Ig strand G 777..780 CDD:409353
IG_like 794..879 CDD:214653
Ig strand B 805..809 CDD:409353
Ig strand C 818..822 CDD:409353
Ig strand E 845..849 CDD:409353
Ig strand F 859..864 CDD:409353
Ig strand G 872..875 CDD:409353
Ig 885..972 CDD:472250
Ig strand C 916..920 CDD:409353
Ig strand E 938..942 CDD:409353
Ig strand F 952..957 CDD:409353
Ig strand G 965..968 CDD:409353
Ig_3 975..1049 CDD:464046
IG_like 1083..1159 CDD:214653
Ig strand B 1089..1093 CDD:409353
Ig strand C 1102..1106 CDD:409353
Ig strand E 1125..1129 CDD:409353
Ig strand F 1139..1144 CDD:409353
Ig strand G 1152..1155 CDD:409353
I-set 1163..1241 CDD:400151
Ig strand B 1180..1184 CDD:409570
Ig strand C 1193..1197 CDD:409570
Ig strand E 1208..1211 CDD:409570
Ig 1637..1714 CDD:472250
Ig strand B 1644..1648 CDD:409353
Ig strand C 1657..1661 CDD:409353
Ig strand E 1680..1684 CDD:409353
Ig strand F 1694..1699 CDD:409353
IG_like 1753..1830 CDD:214653
Ig strand B 1760..1764 CDD:409353
Ig strand C 1773..1777 CDD:409353
Ig strand E 1796..1800 CDD:409353
Ig strand F 1810..1815 CDD:409353
Ig strand G 1823..1826 CDD:409353
I-set 1834..1918 CDD:400151
Ig strand B 1855..1859 CDD:409256
Ig strand C 1868..1872 CDD:409256
Ig strand E 1891..1895 CDD:409256
Ig strand F 1905..1910 CDD:409256
Ig strand G 1918..1921 CDD:409256
Ig 1939..2017 CDD:472250
Ig strand B 1947..1951 CDD:409256
Ig strand C 1960..1964 CDD:409256
Ig strand E 1983..1987 CDD:409256
Ig strand F 1997..2002 CDD:409256
Ig strand G 2010..2013 CDD:409256
I-set 2038..2110 CDD:400151 20/90 (22%)
Ig strand B 2042..2046 CDD:409353 1/3 (33%)
Ig strand C 2055..2059 CDD:409353 1/3 (33%)
Ig strand F 2090..2095 CDD:409353 2/4 (50%)
Ig_3 2113..2189 CDD:464046 26/80 (33%)
Ig_3 2205..2282 CDD:464046 21/82 (26%)
I-set 2307..2391 CDD:400151
Ig strand B 2321..2325 CDD:409353
Ig strand C 2334..2338 CDD:409353
Ig strand E 2357..2361 CDD:409353
Ig strand F 2371..2376 CDD:409353
I-set 2400..2484 CDD:400151
Ig strand B 2414..2418 CDD:409353
Ig strand C 2427..2431 CDD:409353
Ig strand E 2447..2454 CDD:409353
Ig strand F 2464..2469 CDD:409353
Ig_3 2487..2562 CDD:464046
Ig 2599..2667 CDD:472250
Ig strand B 2599..2603 CDD:409353
Ig strand C 2612..2616 CDD:409353
Ig strand E 2635..2639 CDD:409353
Ig strand F 2649..2654 CDD:409353
IG_like 2679..2760 CDD:214653
Ig strand B 2690..2694 CDD:409353
Ig strand C 2703..2707 CDD:409353
Ig strand E 2726..2730 CDD:409353
Ig strand F 2740..2745 CDD:409353
Ig_3 2764..2839 CDD:464046
Ig 2857..2943 CDD:472250
Ig strand B 2873..2877 CDD:409353
Ig strand C 2886..2890 CDD:409353
Ig strand E 2909..2913 CDD:409353
Ig strand F 2923..2928 CDD:409353
Ig strand G 2936..2939 CDD:409353
Ig_3 2946..3020 CDD:464046
Ig_3 3036..3110 CDD:464046
IG_like 3133..3214 CDD:214653
Ig strand B 3144..3148 CDD:409353
Ig strand C 3157..3161 CDD:409353
Ig strand E 3180..3184 CDD:409353
Ig strand F 3194..3199 CDD:409353
Ig strand G 3207..3210 CDD:409353
Ig 3218..3293 CDD:472250
Ig strand B 3235..3239 CDD:409353
Ig strand C 3248..3252 CDD:409353
Ig strand E 3269..3273 CDD:409353
Ig strand F 3283..3288 CDD:409353
I-set 3316..3394 CDD:400151
Ig strand B 3325..3329 CDD:409353
Ig strand C 3338..3342 CDD:409353
Ig strand E 3360..3364 CDD:409353
Ig strand F 3374..3379 CDD:409353
Ig strand G 3387..3390 CDD:409353
TSP1 3401..3452 CDD:214559
G2F 3454..3636 CDD:462175
EGF_CA 3691..3721 CDD:214542
EGF_CA 3731..3775 CDD:214542
EGF_CA 3776..3814 CDD:214542
EGF_CA 3816..3849 CDD:238011
EGF_CA 3858..3889 CDD:429571
EGF_CA 3901..3940 CDD:214542
EGF_CA 4005..4044 CDD:214542
EGF_CA 4045..4085 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.