Sequence 1: | NP_001097100.1 | Gene: | DIP-iota / 33925 | FlyBaseID: | FBgn0031837 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018174.2 | Gene: | lrit1a / 553943 | ZFINID: | ZDB-GENE-040924-5 | Length: | 643 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 49/196 - (25%) |
---|---|---|---|
Similarity: | 77/196 - (39%) | Gaps: | 63/196 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 LLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEHRIWQLKIRDVQE------SD 107
Fly 108 RGWYMCQINTDPMKSQMGYLDVVVPPDIVDYQTSQDVVRS-TGQNVTLTCSATGVPMPTITWRRE 171
Fly 172 EATP----ILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASN--GVPPTVSKRVMLVVNFA 230
Fly 231 P 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-iota | NP_001097100.1 | IG_like | 39..125 | CDD:214653 | 15/81 (19%) |
Ig | 39..122 | CDD:299845 | 15/78 (19%) | ||
Ig | 132..213 | CDD:299845 | 27/85 (32%) | ||
IG_like | 141..227 | CDD:214653 | 29/92 (32%) | ||
IG_like | 239..322 | CDD:214653 | |||
IGc2 | 245..313 | CDD:197706 | |||
lrit1a | NP_001018174.2 | leucine-rich repeat | 61..84 | CDD:275378 | |
LRR_8 | 63..119 | CDD:290566 | |||
LRR_RI | <77..175 | CDD:238064 | |||
leucine-rich repeat | 85..108 | CDD:275378 | |||
LRR_8 | 108..167 | CDD:290566 | |||
leucine-rich repeat | 109..132 | CDD:275378 | |||
leucine-rich repeat | 133..156 | CDD:275378 | |||
leucine-rich repeat | 157..170 | CDD:275378 | |||
LRRCT | 199..243 | CDD:214507 | 11/63 (17%) | ||
I-set | 252..343 | CDD:254352 | 31/100 (31%) | ||
Ig | 259..333 | CDD:299845 | 26/77 (34%) | ||
fn3 | 448..515 | CDD:278470 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |