DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and iglon5

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:299 Identity:82/299 - (27%)
Similarity:136/299 - (45%) Gaps:33/299 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEHRIWQLKIRD 102
            :|.||..|...:|.|.:.:.|:.| |||  :...||.......:.:.|:|:.:..:..:.::|..
Zfish    34 DNITVLEGESVVLRCKIDEEVTHK-AWL--NRSNILFTGTDKWSLDSRVSLENNNNSDFSIRIER 95

  Fly   103 VQESDRGWYMC--QINTDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPT 165
            |..:|.|.|.|  |....|..:.: ||.|.||..||:  .|||...:.|::|.|.|.|.|.|.||
Zfish    96 VMVADEGPYTCSFQARNKPRTAHV-YLIVQVPARIVN--ISQDKSVNEGEDVNLFCLAVGRPEPT 157

  Fly   166 ITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFA 230
            |||:           |....:.: ||:.|.:.:::|.....:.||.:|||.|..:::|.:.||:.
Zfish   158 ITWK-----------DFKYGLLN-EGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTVNYP 210

  Fly   231 PTIWTRYDTIYVGLGQKLTLECITESQPASVNFWLRDSQLLQGGSYESVSVDHVFRIVMRIT--- 292
            |.| |....:...:|:...|.|...:.|.:...|.||.:       ..|..|:..:|....|   
Zfish   211 PII-TDVKNMPAQVGKTAILRCEAMAVPTASFEWYRDDR-------RPVESDNTLKIKNEKTRSL 267

  Fly   293 --LRPITKRDFGEYICRAKNAMGQTDRIITVHHKAKKHG 329
              ...:|::.||.|.|.|.|.:|.::..:.:......:|
Zfish   268 LLFTNVTEKHFGNYTCFASNRLGASNASMLLFRPGAVYG 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 23/87 (26%)
Ig 39..122 CDD:299845 23/84 (27%)
Ig 132..213 CDD:299845 25/80 (31%)
IG_like 141..227 CDD:214653 27/85 (32%)
IG_like 239..322 CDD:214653 19/87 (22%)
IGc2 245..313 CDD:197706 18/72 (25%)
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 25/92 (27%)
Ig 35..123 CDD:299845 25/91 (27%)
Ig 125..>183 CDD:299845 24/71 (34%)
I-set 128..207 CDD:254352 29/92 (32%)
IG_like 217..298 CDD:214653 19/87 (22%)
ig 223..296 CDD:278476 19/79 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm26286
orthoMCL 1 0.900 - - OOG6_117834
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.