DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and dpr15

DIOPT Version :10

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_731672.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster


Alignment Length:266 Identity:62/266 - (23%)
Similarity:97/266 - (36%) Gaps:53/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRI-SISHTEHRIWQLKIRDVQESDR 108
            |..|.|.|.|..||...::|||:....||::.......:.|. |:.......|.|:|:.||..|.
  Fly   204 GTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDE 268

  Fly   109 GWYMCQINTDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTC--SATGVPMPTITWRRE 171
            |.|.||::|:|..|.:.:|.:|.|...:..::::.|  ..|..|.|.|  |....|...|.|...
  Fly   269 GTYECQVSTEPKASAIVHLRIVEPKTELIGESTRHV--KAGSQVKLRCIISQALEPPLFINWFYN 331

  Fly   172 EATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTR 236
            :....|.:..|.|.            :::|..:.|.:        ||.|.........|.|..|.
  Fly   332 QKQIYLHNRRGWRT------------EIERIDLPAEV--------PTTSTTTTTTTTTASTTTTT 376

  Fly   237 YDTIYVGLGQKLTLECITESQPASVNFWLRDSQLLQGGSYESVSVDHVFRIVMRIT----LRPIT 297
            ..|              |.:.|::.          ..||.|..:.......::.||    |..|:
  Fly   377 TST--------------TPATPSTT----------ATGSTEGATSSETLNGLVTITRSYILDAIS 417

  Fly   298 KRDFGE 303
            :.|..|
  Fly   418 QNDVSE 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 27/80 (34%)
Ig strand B 48..52 CDD:143290 2/3 (67%)
Ig strand C 61..65 CDD:143290 0/3 (0%)
Ig strand E 96..100 CDD:143290 2/3 (67%)
Ig strand F 110..115 CDD:143290 2/4 (50%)
Ig 133..227 CDD:472250 17/95 (18%)
Ig strand B 152..156 CDD:409562 2/3 (67%)
Ig strand C 165..169 CDD:409562 1/3 (33%)
Ig strand E 192..196 CDD:409562 0/3 (0%)
Ig strand F 206..211 CDD:409562 1/4 (25%)
Ig strand G 220..223 CDD:409562 1/2 (50%)
Ig_3 231..310 CDD:464046 14/77 (18%)
dpr15NP_731672.1 V-set 204..290 CDD:462230 28/85 (33%)

Return to query results.
Submit another query.