DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and dpr17

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:208 Identity:63/208 - (30%)
Similarity:90/208 - (43%) Gaps:24/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRI-SISHTEH-RIWQL 98
            |:.|.|..:|..|.:.|.:|.|....|:|:|:....|:|:.......:.|. ||...:| ..|.|
  Fly   411 PVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSL 475

  Fly    99 KIRDVQESDRGWYMCQINTDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGV-- 161
            :|:.|:.||.|||.||:.|:|..|...:|.:|.|...:....|:.|  ..|..|.|.|...|.  
  Fly   476 QIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSRFV--KAGSKVALHCIVRGTLD 538

  Fly   162 PMPTITWRREEATPILISDDG---------DREVFSVEGQN------LTLWQVQRSHMGAYLCIA 211
            |...|.|.|.:..   |||..         ||.:|...|.|      |.:..|::...|.|.|..
  Fly   539 PPKYIIWFRGQKK---ISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQP 600

  Fly   212 SNGVPPTVSKRVM 224
            ||.|..:|...|:
  Fly   601 SNSVSVSVDLHVL 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 30/87 (34%)
Ig 39..122 CDD:299845 29/84 (35%)
Ig 132..213 CDD:299845 25/97 (26%)
IG_like 141..227 CDD:214653 29/101 (29%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 25/76 (33%)
Ig 415..507 CDD:299845 30/91 (33%)
IG_like 521..612 CDD:214653 27/95 (28%)
IGc2 524..605 CDD:197706 24/83 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12107
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.