DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and dpr11

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:255 Identity:68/255 - (26%)
Similarity:97/255 - (38%) Gaps:48/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPKFSG-PINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEH 93
            :|...| ..:|.|..:|..|.|.|.|..|.:..|:|:|:....||::...|...:.|........
  Fly   116 EPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPD 180

  Fly    94 RIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSA 158
            :.|.|:|:.||..|.|.|.||::|:|..|....|.||||.  .:.....|.....|.||.|.|..
  Fly   181 KYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPR--TEILGEPDRYVKAGSNVVLRCIV 243

  Fly   159 TGV--PMPTITW-------------RREEATPILISDDGDREVFSVEGQ----NLTLWQVQRSHM 204
            .|.  |...|.|             .|.:..|.|....|       |||    :|.:...::...
  Fly   244 RGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASG-------EGQSTIGSLIIESAKKRDT 301

  Fly   205 GAYLCIASNGVPPTVSKRVM-------LVVNFAPTIWTR----------YDTIYVGLGQK 247
            |.|.|..||....||:..::       .|.:.|.|  ||          ...|.:|:|.:
  Fly   302 GNYTCSPSNSPSATVTLNIINGESSASAVTSSAAT--TRAYALSILALLLSVILIGVGHR 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 28/85 (33%)
Ig 39..122 CDD:299845 27/82 (33%)
Ig 132..213 CDD:299845 22/99 (22%)
IG_like 141..227 CDD:214653 25/111 (23%)
IG_like 239..322 CDD:214653 3/9 (33%)
IGc2 245..313 CDD:197706 1/3 (33%)
dpr11NP_001262320.1 I-set 125..216 CDD:254352 29/90 (32%)
Ig 127..217 CDD:299845 28/89 (31%)
IG_like 227..320 CDD:214653 25/99 (25%)
IGc2 234..311 CDD:197706 21/83 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.