DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and dpr16

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:255 Identity:58/255 - (22%)
Similarity:96/255 - (37%) Gaps:68/255 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRI---------- 86
            :.|.|..|:||..|:.|.|.|.::......::|:|:..:.|:::.:.....:.|.          
  Fly   200 QLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLT 264

  Fly    87 ------SISHT-----------EHRI-------------WQLKIRDVQESDRGWYMCQINTDPMK 121
                  ::|.|           .|.:             |.|:|:.|...|.|||.||:.|:|..
  Fly   265 TLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKM 329

  Fly   122 SQMGYLDVVVP-PDIVDYQTSQDVVRSTGQNVTLTCSATG-VPMPT-ITWRR--------EEATP 175
            |....|.|:.| .:::.  ..|..|:: |..|.|.|...| :..|. |.|.|        .||:.
  Fly   330 SAKVQLFVITPRTELIG--DRQRFVKA-GSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASG 391

  Fly   176 ILISDDG-----DREVFSVEGQN------LTLWQVQRSHMGAYLCIASNGVPPTVSKRVM 224
               :..|     ||.:|.....|      |.:..|::.|.|.|.|...|....::...|:
  Fly   392 ---AQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVL 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 27/125 (22%)
Ig 39..122 CDD:299845 26/122 (21%)
Ig 132..213 CDD:299845 25/102 (25%)
IG_like 141..227 CDD:214653 26/105 (25%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 28/131 (21%)
Ig <298..338 CDD:299845 14/39 (36%)
IG_like 352..447 CDD:214653 24/98 (24%)
Ig 358..439 CDD:143165 22/83 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.