DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and LSAMP

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:407 Identity:115/407 - (28%)
Similarity:169/407 - (41%) Gaps:93/407 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RRLPSFWLLLLQSVCFSQASFSELNNSDPKFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRV 67
            ::||   |:||:.:|...... .:.:.|  |:...:|.||..|..|:|.|||.|..| |||||. 
Human    10 KQLP---LVLLRLLCLLPTGL-PVRSVD--FNRGTDNITVRQGDTAILRCVVEDKNS-KVAWLN- 66

  Fly    68 DTQTILSIQNHVITKNH-------RISISHTEHRIWQLKIRDVQESDRGWYMCQINT--DPMKSQ 123
                    ::.:|...|       |:.:.......:.|:|:.|...|.|.|.|.:.|  :|..||
Human    67 --------RSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQ 123

  Fly   124 MGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFS 188
            : ||.|.|||.|.:  .|.||..:.|.||||.|.|.|.|.|.||||  ..||.....:|:.|...
Human   124 V-YLIVQVPPKISN--ISSDVTVNEGSNVTLVCMANGRPEPVITWR--HLTPTGREFEGEEEYLE 183

  Fly   189 VEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECI 253
            :.|       :.|...|.|.|.|:|.|.....|:|.:.||:.||| |...:.....|::.:|:|.
Human   184 ILG-------ITREQSGKYECKAANEVSSADVKQVKVTVNYPPTI-TESKSNEATTGRQASLKCE 240

  Fly   254 TESQPASVNFWLRDSQLLQGG------SYESVSVDHVFRIVMRITLRPITKRDFGEYICRAKNAM 312
            ..:.||....|.||...:...      |.|..|         .:|:..:|:..:|.|.|.|.|.:
Human   241 ASAVPAPDFEWYRDDTRINSANGLEIKSTEGQS---------SLTVTNVTEEHYGNYTCVAANKL 296

  Fly   313 GQTD-------RII------------TVHHKAKKHGQHSHQTSSRESQFIVIEEYIANMSDKSCS 358
            |.|:       |::            |||.|.|..|.                  :..::.....
Human   297 GVTNASLVLFKRVLPTIPHPIQEIGTTVHFKQKGPGS------------------VRGINGSISL 343

  Fly   359 FQPLWIM---FLCFVNK 372
            ..|||::   .||.::|
Human   344 AVPLWLLAASLLCLLSK 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 30/94 (32%)
Ig 39..122 CDD:299845 28/91 (31%)
Ig 132..213 CDD:299845 30/80 (38%)
IG_like 141..227 CDD:214653 31/85 (36%)
IG_like 239..322 CDD:214653 22/107 (21%)
IGc2 245..313 CDD:197706 18/73 (25%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 32/100 (32%)
Ig 132..215 CDD:386229 33/93 (35%)
Ig_3 219..294 CDD:372822 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143414
Domainoid 1 1.000 59 1.000 Domainoid score I10656
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.