DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and CG7166

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:326 Identity:97/326 - (29%)
Similarity:147/326 - (45%) Gaps:33/326 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FWLLLLQSVCFSQA----SFSELNNSDPKFSGPINNS-----TVPVGRDALLTCVVHDLVSFKVA 63
            :|.|:|....||.:    ||. |..:||..:.|...|     .|.||....|.|.|.:|.||.:.
  Fly     8 YWTLVLYLFSFSLSLIGGSFI-LPENDPPTTAPKFLSRGHLYKVIVGETIELPCKVQNLGSFVLL 71

  Fly    64 WLRVDTQTILSIQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLD 128
            |.:  ..::|:..:..||::.|..|...    :.|:|..|:..|.|.|:||:.....:.|:..::
  Fly    72 WRK--GSSVLTAGHLKITRDQRFKIVGD----YNLQINGVKTQDAGDYICQLGDQENRDQVHTVE 130

  Fly   129 VVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREE--ATPILISDDGDREVFSVEG 191
            ::|||.:.....:..|....|..|||.|.|:|.|:|||.|.:::  :.|..:||          .
  Fly   131 ILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFKKDVFSGPTHLSD----------S 185

  Fly   192 QNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITES 256
            ..|.|..|.|.|.|.|.|.|.|||...||..:.|.:...|.|......::...|..:.|.||...
  Fly   186 STLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVEKSWVHASEGYDVELVCIVHG 250

  Fly   257 QPASVNFWLRDSQLLQGGSYESV-SVDHVFRIVMRITLRPITKRDFGEYICRAKNAMGQTDRIIT 320
            ...|...|.::|.||......|: ..|..:.:::| ..:|   .|||.|.|.|.||:|:|.:.|.
  Fly   251 DVNSEMLWYQNSFLLDATDRRSMYPRDDRYSLIIR-NFQP---TDFGNYSCVADNALGRTKKYIE 311

  Fly   321 V 321
            |
  Fly   312 V 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 25/90 (28%)
Ig 39..122 CDD:299845 24/87 (28%)
Ig 132..213 CDD:299845 27/82 (33%)
IG_like 141..227 CDD:214653 31/87 (36%)
IG_like 239..322 CDD:214653 25/84 (30%)
IGc2 245..313 CDD:197706 21/68 (31%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 24/88 (27%)
Ig 56..116 CDD:143165 18/65 (28%)
IG_like 144..221 CDD:214653 31/86 (36%)
IGc2 151..209 CDD:197706 25/67 (37%)
IG_like 232..313 CDD:214653 25/85 (29%)
Ig 242..311 CDD:143165 22/72 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
32.810

Return to query results.
Submit another query.