DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and ImpL2

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:199 Identity:44/199 - (22%)
Similarity:75/199 - (37%) Gaps:46/199 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 RSTGQNVTLTCSATGVPMPTITW-----RREEATPILISDDGDREVFSVEGQNLTLWQVQRSHM- 204
            ::.|..:.:.|...|..:|:|.|     .|.|.      ||.|....:.|..: .:.:|:.||: 
  Fly    70 QADGATIEIVCEMMGSQVPSIQWVVGHLPRSEL------DDLDSNQVAEEAPS-AIVRVRSSHII 127

  Fly   205 -------GAYLCI---------ASNGVPPTVSKRVMLVVNF----APTIWTRYDTIYVGLGQKLT 249
                   ..|.|:         ||..|.|..|.|:.....:    .|.|.....|....:|..:.
  Fly   128 DHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQ 192

  Fly   250 LECITESQPASVNFWL--RDSQLLQGGSYESVSVDHVFRIVMR--ITLRPITKRDFGEYICRAKN 310
            |.|...::|.:...||  .:.:::||         |..|::..  :.:..|...|.|.|.|.|:|
  Fly   193 LPCRVHARPRAEITWLNNENKEIVQG---------HRHRVLANGDLLISEIKWEDMGNYKCIARN 248

  Fly   311 AMGQ 314
            .:|:
  Fly   249 VVGK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653
Ig 39..122 CDD:299845
Ig 132..213 CDD:299845 18/88 (20%)
IG_like 141..227 CDD:214653 23/102 (23%)
IG_like 239..322 CDD:214653 19/80 (24%)
IGc2 245..313 CDD:197706 17/71 (24%)
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.